Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Human (223a.a, HEK293, His)

The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (223a.a, HEK293, His) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

M-CSF Protein, Human (223a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-human-hek-293-his.html

Purity

98.0

Smiles

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR

Molecular Formula

1435 (Gene_ID) P09603-1 (E33-R255) (Accession)

Molecular Weight

Approximately 34-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEF1 Antibody
A27401-50UG 50 µg

LEF1 Antibody

Sign In for Pricing
View Details
C13orf24 (PIBF1) Rabbit Polyclonal Antibody
TA372132 100 µL

C13orf24 (PIBF1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CX3CL1/Fractalkine Rabbit anti-Human Polyclonal Antibody
MBS2403750-01 0.05 mg

CX3CL1/Fractalkine Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
CX3CL1/Fractalkine Rabbit anti-Human Polyclonal Antibody
MBS2403750-02 5x 0.05 mg

CX3CL1/Fractalkine Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
Lung small cell cancer tissue array, including pathology TNM and clinical stage, 44 cases/44 cores, replacing LC703.-LC703a
LC703a each

Lung small cell cancer tissue array, including pathology TNM and clinical stage, 44 cases/44 cores, replacing LC703.-LC703a

Sign In for Pricing
View Details
Lentiviral human MAP3K19 shRNA (UAS) - Lentiviral human MAP3K19 shRNA (UAS, GFP) (25)
GTR15339743 1 Vial

Lentiviral human MAP3K19 shRNA (UAS) - Lentiviral human MAP3K19 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details