Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1, Mouse (HEK293, His)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD200R1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Molecular Formula

57781 (Gene_ID) Q9ES57/NP_067300.1 (T26-P238) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HLA-DR (DR alpha chain, DRB1, DRB4, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen DR alpha chain, HLA DR1B, HLA DR3B, HLA DRA, HLA DRA1, HLA DRB1, HLA DRB3, HLA DRB4, HLA DRB5, HLA-DRA, HLADR4B, HLADRA1, HLADRB, Major histocompatibility complex class II DR alpha, Major histocompatibility complex class II DR beta 1, Major histocompatibility complex class II DR beta 3, Major histocompatibility complex class II DR beta 4, Major histocompatibility complex class II DR beta 5, MHC cell surface GlycoProtein, MHC class II antigen DRA) (APC)
172107-AF-APC 100 µL

HLA-DR (DR alpha chain, DRB1, DRB4, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen DR alpha chain, HLA DR1B, HLA DR3B, HLA DRA, HLA DRA1, HLA DRB1, HLA DRB3, HLA DRB4, HLA DRB5, HLA-DRA, HLADR4B, HLADRA1, HLADRB, Major histocompatibility complex class II DR alpha, Major histocompatibility complex class II DR beta 1, Major histocompatibility complex class II DR beta 3, Major histocompatibility complex class II DR beta 4, Major histocompatibility complex class II DR beta 5, MHC cell surface GlycoProtein, MHC class II antigen DRA) (APC)

Ask
View Details
C21orf7 (MAP3K7CL) (NM_001286623) Human Tagged ORF Clone
RC235823 10 µg

C21orf7 (MAP3K7CL) (NM_001286623) Human Tagged ORF Clone

Ask
View Details
Rabbit anti-BMALl Antibody, Affinity Purified
A302-616A-T 10 µg

Rabbit anti-BMALl Antibody, Affinity Purified

Ask
View Details
Rabbit Polyclonal TUG Antibody [Alexa Fluor 647]
NBP1-28709AF647 0.1 mL

Rabbit Polyclonal TUG Antibody [Alexa Fluor 647]

Ask
View Details
UBN1 Antibody
MBS8594415-01 0.1 mg

UBN1 Antibody

Ask
View Details
UBN1 Antibody
MBS8594415-02 0.1 mL (AF405L)

UBN1 Antibody

Ask
View Details