Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1, Mouse (HEK293, His)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD200R1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Molecular Formula

57781 (Gene_ID) Q9ES57/NP_067300.1 (T26-P238) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH7 Protein Vector (Mouse) (pPM-C-HA)
PV213944 500 ng

PCDH7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae HI_0870 Protein (aa 1-34)
VAng-Lsx03313-500gEcoli 500 µg (E. coli)

Recombinant Haemophilus Influenzae HI_0870 Protein (aa 1-34)

Sign In for Pricing
View Details
CHAC1 (NM_001142776) Human Mass Spec Standard
PH327708 10 µg

CHAC1 (NM_001142776) Human Mass Spec Standard

Sign In for Pricing
View Details
Nutrient Mixture Ham's F-12 Coon's Modification w/L-Glutamine, Zinc Sulfate (Powder)
MBS652750-01 10 L

Nutrient Mixture Ham's F-12 Coon's Modification w/L-Glutamine, Zinc Sulfate (Powder)

Sign In for Pricing
View Details
Nutrient Mixture Ham's F-12 Coon's Modification w/L-Glutamine, Zinc Sulfate (Powder)
MBS652750-02 25 L

Nutrient Mixture Ham's F-12 Coon's Modification w/L-Glutamine, Zinc Sulfate (Powder)

Sign In for Pricing
View Details
Nutrient Mixture Ham's F-12 Coon's Modification w/L-Glutamine, Zinc Sulfate (Powder)
MBS652750-03 50 L

Nutrient Mixture Ham's F-12 Coon's Modification w/L-Glutamine, Zinc Sulfate (Powder)

Sign In for Pricing
View Details