Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1, Mouse (HEK293, His)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD200R1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Molecular Formula

57781 (Gene_ID) Q9ES57/NP_067300.1 (T26-P238) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIX3 (SIX Homeobox 3, HPE2) (MaxLight 405)
MBS6197845-01 0.1 mL

SIX3 (SIX Homeobox 3, HPE2) (MaxLight 405)

Sign In for Pricing
View Details
SIX3 (SIX Homeobox 3, HPE2) (MaxLight 405)
MBS6197845-02 5x 0.1 mL

SIX3 (SIX Homeobox 3, HPE2) (MaxLight 405)

Sign In for Pricing
View Details
Human IPO9 Pre-designed siRNA Set B
SI007736B 1 Each

Human IPO9 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ERGIC1 Protein Vector (Human) (pPM-C-HA)
PV014499 500 ng

ERGIC1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
RGD1564114 CRISPRa sgRNA lentivector (set of three targets)(Rat)
39352126 3x 1.0µg DNA

RGD1564114 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
ALKBH2 siRNA (Human)
CRJ4683-01 15 nmol

ALKBH2 siRNA (Human)

Sign In for Pricing
View Details