Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1, Mouse (HEK293, His)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD200R1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Molecular Formula

57781 (Gene_ID) Q9ES57/NP_067300.1 (T26-P238) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC4H2 Recombinant Protein (Rat)
RP237971 100 µg

ZC4H2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Rat Myostatin (MSTN) ELISA Kit
EKN49840 96 Tests

Rat Myostatin (MSTN) ELISA Kit

Sign In for Pricing
View Details
Mouse Scfd1 (NM_029825) AAV Particle
MR220601A1V 250 µL

Mouse Scfd1 (NM_029825) AAV Particle

Sign In for Pricing
View Details
SCXB CRISPRa sgRNA lentivector (set of three targets)(Human)
43214121 3x 1.0µg DNA

SCXB CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
STAT6 AAV Vector (Mouse) (CMV)
45701104 1 µg

STAT6 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
HES4 (NM_001142467) Human Tagged Lenti ORF Clone
RC227268L4 10 µg

HES4 (NM_001142467) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details