Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1, Mouse (HEK293, His)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD200R1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Molecular Formula

57781 (Gene_ID) Q9ES57/NP_067300.1 (T26-P238) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WARS2 Rabbit pAb (APR21943N)
APR21943N-01 50 µL

WARS2 Rabbit pAb (APR21943N)

Sign In for Pricing
View Details
WARS2 Rabbit pAb (APR21943N)
APR21943N-02 100 µL

WARS2 Rabbit pAb (APR21943N)

Sign In for Pricing
View Details
WARS2 Rabbit pAb (APR21943N)
APR21943N-03 200 µL

WARS2 Rabbit pAb (APR21943N)

Sign In for Pricing
View Details
KCNK13 Antibody; FITC conjugated
MBS7002239-01 0.05 mg

KCNK13 Antibody; FITC conjugated

Sign In for Pricing
View Details
KCNK13 Antibody; FITC conjugated
MBS7002239-02 0.1 mg

KCNK13 Antibody; FITC conjugated

Sign In for Pricing
View Details
KCNK13 Antibody; FITC conjugated
MBS7002239-03 5x 0.1 mg

KCNK13 Antibody; FITC conjugated

Sign In for Pricing
View Details