Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1, Mouse (HEK293, His)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD200R1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Molecular Formula

57781 (Gene_ID) Q9ES57/NP_067300.1 (T26-P238) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbccd1 3'UTR Luciferase Stable Cell Line
TU221649 1.0 mL

Tbccd1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal USP10 Antibody (OTI2E1) [Janelia Fluor 549]
NBP2-74798JF549 0.1 mL

Mouse Monoclonal USP10 Antibody (OTI2E1) [Janelia Fluor 549]

Sign In for Pricing
View Details
METTL22 Recombinant Protein (Mouse)
RP150314 100 µg

METTL22 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
GPR18 shRNA (m) Lentiviral Particles
sc-75171-V 200 µL

GPR18 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Glypican 3 (GPC3) Rabbit mAb
MBS9147804-01 0.02 mL

Glypican 3 (GPC3) Rabbit mAb

Sign In for Pricing
View Details
Glypican 3 (GPC3) Rabbit mAb
MBS9147804-02 0.1 mL

Glypican 3 (GPC3) Rabbit mAb

Sign In for Pricing
View Details