Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1, Mouse (HEK293, His)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD200R1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Molecular Formula

57781 (Gene_ID) Q9ES57/NP_067300.1 (T26-P238) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paired Box Protein Pax-2 (PAX2) Antibody
abx002211-01 60 µL

Paired Box Protein Pax-2 (PAX2) Antibody

Sign In for Pricing
View Details
Paired Box Protein Pax-2 (PAX2) Antibody
abx002211-02 120 µL

Paired Box Protein Pax-2 (PAX2) Antibody

Sign In for Pricing
View Details
Paired Box Protein Pax-2 (PAX2) Antibody
abx002211-03 200 µL

Paired Box Protein Pax-2 (PAX2) Antibody

Sign In for Pricing
View Details
2- (Trifluoromethyl) aniline-d2
159245 25 mg

2- (Trifluoromethyl) aniline-d2

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid protein (D63G, R203M, D377Y), His Tag
NUN-C52Hs-100ug 100 µg

SARS-CoV-2 Nucleocapsid protein (D63G, R203M, D377Y), His Tag

Sign In for Pricing
View Details
FCGR1A/CD64 Polyclonal Antibody Bio Conjugated
MBS9463596-01 0.1 mL

FCGR1A/CD64 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details