Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1, Mouse (HEK293, His)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD200R1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1-protein-mouse-hek293-his.html

Purity

95.0

Smiles

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Molecular Formula

57781 (Gene_ID) Q9ES57/NP_067300.1 (T26-P238) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NCK2 (Cytoplasmic Protein NCK2, Growth Factor Receptor-bound Protein 4, NCK adaptor Protein 2, Nck-2, SH2/SH3 adaptor Protein NCK-beta, NCK2, GRB4) discontinued
224416-01 50 µL

NCK2 (Cytoplasmic Protein NCK2, Growth Factor Receptor-bound Protein 4, NCK adaptor Protein 2, Nck-2, SH2/SH3 adaptor Protein NCK-beta, NCK2, GRB4) discontinued

Ask
View Details
NCK2 (Cytoplasmic Protein NCK2, Growth Factor Receptor-bound Protein 4, NCK adaptor Protein 2, Nck-2, SH2/SH3 adaptor Protein NCK-beta, NCK2, GRB4) discontinued
224416-02 100 µL

NCK2 (Cytoplasmic Protein NCK2, Growth Factor Receptor-bound Protein 4, NCK adaptor Protein 2, Nck-2, SH2/SH3 adaptor Protein NCK-beta, NCK2, GRB4) discontinued

Ask
View Details
Rat GFAP (Glial Fibrillary Acidic Protein) ValidElisa Kit
EK342537 96 Well

Rat GFAP (Glial Fibrillary Acidic Protein) ValidElisa Kit

Ask
View Details
JYL 1421
MF-0012473-01 1 mg

JYL 1421

Ask
View Details
JYL 1421
MF-0012473-02 1 mL - 10 mM (in DMSO)

JYL 1421

Ask
View Details
JYL 1421
MF-0012473-03 5 mg

JYL 1421

Ask
View Details