Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAC/Diablo, Human (His)

SMAC/Diablo protein is a core participant in apoptosis and activates caspases in the cytochrome c/Apaf-1/caspase-9 pathway. It antagonizes inhibitors of apoptosis proteins (IAPs), inhibits the binding of BIRC6/bruce to caspases and destabilizes XIAP/BIRC4. SMAC/Diablo Protein, Human (His) is the recombinant human-derived SMAC/Diablo protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

SMAC/Diablo Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smac-diablo-protein-human-his.html

Purity

95.0

Smiles

AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Molecular Formula

56616 (Gene_ID) Q9NR28-1 (A56-D239) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF405S conjugate, 0.1mg/mL
BNC042313-500 1x 500 µL

Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF740 conjugate, 0.1mg/mL
BNC741380-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL
BNC882171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF647 conjugate, 0.1mg/mL
BNC472616-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details