Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAC/Diablo, Human (His)

SMAC/Diablo protein is a core participant in apoptosis and activates caspases in the cytochrome c/Apaf-1/caspase-9 pathway. It antagonizes inhibitors of apoptosis proteins (IAPs), inhibits the binding of BIRC6/bruce to caspases and destabilizes XIAP/BIRC4. SMAC/Diablo Protein, Human (His) is the recombinant human-derived SMAC/Diablo protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

SMAC/Diablo Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/smac-diablo-protein-human-his.html

Purity

95.0

Smiles

AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Molecular Formula

56616 (Gene_ID) Q9NR28-1 (A56-D239) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOC Polyclonal Antibody
JOT-AP14484-01 20 µL

BOC Polyclonal Antibody

Sign In for Pricing
View Details
BOC Polyclonal Antibody
JOT-AP14484-02 50 μL

BOC Polyclonal Antibody

Sign In for Pricing
View Details
BOC Polyclonal Antibody
JOT-AP14484-03 100 µL

BOC Polyclonal Antibody

Sign In for Pricing
View Details
Human Connexin 26, CX26 ELISA KIT
E7137Hu-01 48 Well

Human Connexin 26, CX26 ELISA KIT

Sign In for Pricing
View Details
Human Connexin 26, CX26 ELISA KIT
E7137Hu-02 96 Well

Human Connexin 26, CX26 ELISA KIT

Sign In for Pricing
View Details
Human Connexin 26, CX26 ELISA KIT
E7137Hu-03 5x 96 Tests

Human Connexin 26, CX26 ELISA KIT

Sign In for Pricing
View Details