Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Protein E6 (E6)

Product Specifications

Abbreviation

Recombinant Human papillomavirus type 16 E6 protein

Gene Name

E6

UniProt

P03126

Expression Region

1-158aa

Organism

Human papillomavirus type 16

Target Sequence

MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT) . The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12936554/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Glucagon like peptide 1 (GLP-1/GLP1, 7-36) amide
GLP17-P-500 500 µg

Human Glucagon like peptide 1 (GLP-1/GLP1, 7-36) amide

Ask
View Details
IMP3 (IGF2BP3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A4]
TA811488AM 100 µL

IMP3 (IGF2BP3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A4]

Ask
View Details
Mouse Monoclonal CD46 Antibody (122.2) - Azide and BSA Free
NBP2-33159 0.1 mg

Mouse Monoclonal CD46 Antibody (122.2) - Azide and BSA Free

Ask
View Details
2-Chloro-9,10-bis (2- (4-methoxyphenyl) ethynyl) anthracene
OR1075949 25 g

2-Chloro-9,10-bis (2- (4-methoxyphenyl) ethynyl) anthracene

Ask
View Details
PDCL3P2 Adenovirus (Human)
36272051 1.0 ml

PDCL3P2 Adenovirus (Human)

Ask
View Details
Spinophilin (Neurabin-2, Neurabin-II, Protein Phosphatase 1 Regulatory Subunit 9B, PPP1R9B, PPP1R6) (MaxLight 750)
MBS6444818-01 0.1 mL

Spinophilin (Neurabin-2, Neurabin-II, Protein Phosphatase 1 Regulatory Subunit 9B, PPP1R9B, PPP1R6) (MaxLight 750)

Ask
View Details