Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta 3/TGFB3, Human (HEK293)

TGF-β3 (transforming growth factor-β3) is a member of a TGF­-beta superfamily subgroup that performs many cellular functions. TGF-β3 has a role in embryogenesis and cell differentiation. TGF-β3 also plays a critical role in palatogenesis, the wound healing process. TGF-β3 is capable of binding directly to the type II receptor (TβRII) [1][2]. TGF beta 3/TGFB3 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A301-S412) .

Product Specifications

Product Name Alternative

TGF beta 3/TGFB3 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/tgf-beta-3-protein-human-mouse-rat-hek293.html

Purity

98.0

Smiles

ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

Molecular Formula

7043 (Gene_ID) P10600-1 (A301-S412) (Accession)

Molecular Weight

Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Mahmoudi Rad M, et al. Expression of TGF-β3 in isolated fibroblasts from foreskin. Rep Biochem Mol Biol. 2015 Apr;3 (2) :76-81.|[2]Laverty HG, et al. TGF-beta3 and cancer: a review. Cytokine Growth Factor Rev. 2009 Aug;20 (4) :305-17.|[3]Toshihiko Komai, et al. Reevaluation of Pluripotent Cytokine TGF-β3 in Immunity. Int J Mol Sci. 2018 Aug 1;19 (8) :2261.|[4]A Arici, et al. Transforming growth factor-beta3 is expressed at high levels in leiomyoma where it stimulates fibronectin expression and cell proliferation. Fertil Steril. 2000 May;73 (5) :1006-11.|[5]Muhetaer Huojia, et al. TGF-beta3 induces ectopic mineralization in fetal mouse dental pulp during tooth germ development. Dev Growth Differ. 2005 Apr;47 (3) :141-52.|[6]Long Xu, et al. Transforming growth factor β3 attenuates the development of radiation-induced pulmonary fibrosis in mice by decreasing fibrocyte recruitment and regulating IFN-γ/IL-4 balance. Immunol Lett. 2014 Nov;162 (1 Pt A) :27-33.|[7]S Coerper, et al. Recombinant human transforming growth factor beta 3 accelerates gastric ulcer healing in rats. Scand J Gastroenterol. 1997 Oct;32 (10) :985-90.|[8]W Y Lui, et al. Transforming growth factor-beta3 perturbs the inter-Sertoli tight junction permeability barrier in vitro possibly mediated via its effects on occludin, zonula occludens-1, and claudin-11. Endocrinology. 2001 May;142 (5) :1865-77.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-100 1x 100 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-500 1x 500 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-500 1x 500 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-500 1x 500 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details