Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKK1 Knockout HEK293T cell line
GTR15420185 1 Vial

Human ANKK1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Phospho-CDC25A  (Ser124)  Antibody
ABF3254 100 µg

Phospho-CDC25A (Ser124) Antibody

Sign In for Pricing
View Details
Monoclonal Tyrosinase (Melanoma Marker) Antibody - With BSA and Azide, Clone: T311
APG01327G 0.05mg

Monoclonal Tyrosinase (Melanoma Marker) Antibody - With BSA and Azide, Clone: T311

Sign In for Pricing
View Details
Anti-HLA-A2-peptide (ITDQVPFSV) Complex (1A7)
RHM03005 100 μg

Anti-HLA-A2-peptide (ITDQVPFSV) Complex (1A7)

Sign In for Pricing
View Details
ISOC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV681843 1.0 µg DNA

ISOC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Carboxypeptidase Z (CPZ) ELISA Kit
abx505028 96 Tests

Mouse Carboxypeptidase Z (CPZ) ELISA Kit

Sign In for Pricing
View Details