Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEBP1P1 3'UTR GFP Stable Cell Line
TU067715 1.0 mL

PEBP1P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (MaxLight 550)
252899-ML550 100 µL

TOPORS (Topoisomerase I Binding, Arginine/Serine-Rich, LUN, P53BP3, RP31, TP53BPL) (MaxLight 550)

Sign In for Pricing
View Details
Smarcd3 (NM_025891) Mouse Tagged ORF Clone
MG207736 10 µg

Smarcd3 (NM_025891) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant PITX3 Antibody
RN-082-01 50 μL

Recombinant PITX3 Antibody

Sign In for Pricing
View Details
Recombinant PITX3 Antibody
RN-082-02 100 µL

Recombinant PITX3 Antibody

Sign In for Pricing
View Details
Recombinant PITX3 Antibody
RN-082-03 1 mL

Recombinant PITX3 Antibody

Sign In for Pricing
View Details