Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KBTBD10 Protein Vector (Mouse) (pPM-C-HA)
PV193164 500 ng

KBTBD10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Scamp1 3'UTR GFP Stable Cell Line
TU269944 1.0 mL

Scamp1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal UbcH5b/UBE2D2 Antibody (OTI2C2) [Alexa Fluor 594]
NBP2-74732AF594 0.1 mL

Mouse Monoclonal UbcH5b/UBE2D2 Antibody (OTI2C2) [Alexa Fluor 594]

Sign In for Pricing
View Details
Rabbit Polyclonal HPSC152 Antibody
NBP1-92008-25ul 25 µL

Rabbit Polyclonal HPSC152 Antibody

Sign In for Pricing
View Details
Anti-ZNF280A Antibody
CPA2857-01 30 µL

Anti-ZNF280A Antibody

Sign In for Pricing
View Details
Anti-ZNF280A Antibody
CPA2857-02 50 μL

Anti-ZNF280A Antibody

Sign In for Pricing
View Details