VSIG4, Human (HEK293, Fc)
VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
VSIG4 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html
Purity
98.0
Smiles
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV
Molecular Formula
11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)
Molecular Weight
Approximately 75.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
50693061 1.0 µg DNA
ZBTB20-AS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 037508-HRP 200 µL
KIT, phosphorylated (Y578) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 
MBS2085081-01 0.1 mL
HRP-Linked Polyclonal Antibody to Peptidase Inhibitor 16 (PI16)
Sign In for Pricing
View Details MBS2085081-02 0.2 mL
HRP-Linked Polyclonal Antibody to Peptidase Inhibitor 16 (PI16)
Sign In for Pricing
View Details MBS2085081-03 0.5 mL
HRP-Linked Polyclonal Antibody to Peptidase Inhibitor 16 (PI16)
Sign In for Pricing
View Details