VSIG4, Human (HEK293, Fc)
VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
VSIG4 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html
Purity
98.0
Smiles
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV
Molecular Formula
11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)
Molecular Weight
Approximately 75.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS3907752-01 0.0025 mg
Rabbit anti-Tip41 IHC Antibody, Affinity Purified
Sign In for Pricing
View Details 
MBS3907752-02 8 mL
Rabbit anti-Tip41 IHC Antibody, Affinity Purified
Sign In for Pricing
View Details MBS3907752-03 5x 0.0025 mg
Rabbit anti-Tip41 IHC Antibody, Affinity Purified
Sign In for Pricing
View Details 
MBS3907752-04 5x 0.025 mg
Rabbit anti-Tip41 IHC Antibody, Affinity Purified
Sign In for Pricing
View Details MBS6224269-01 0.1 mL
REEP5 (C5orf18, DP1, TB2, Receptor Expression-enhancing Protein 5, Polyposis Locus Protein 1, Protein TB2, MGC70440) (MaxLight 650)
Sign In for Pricing
View Details