Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maml1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3735806 1.0 µg DNA

Maml1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Beta-defensin 50 (DEFB50) ELISA Kit
abx510232 96 Tests

Mouse Beta-defensin 50 (DEFB50) ELISA Kit

Sign In for Pricing
View Details
Plant Laminin (LN) ELISA Kit
MBS9380924 Inquire

Plant Laminin (LN) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Rpusd2 shRNA (UAS) - Lentiviral mouse Rpusd2 shRNA (UAS, iRFP) (25)
GTR15147854 1 Vial

Lentiviral mouse Rpusd2 shRNA (UAS) - Lentiviral mouse Rpusd2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
KRT19
030386 100 µL

KRT19

Sign In for Pricing
View Details
Mouse Coronin-1B, Coro1b ELISA KIT
ELI-33930m 96 Tests

Mouse Coronin-1B, Coro1b ELISA KIT

Sign In for Pricing
View Details