Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 3 (CLDN3) Antibody
abx020547 1 mg

Claudin 3 (CLDN3) Antibody

Sign In for Pricing
View Details
Hoxd13 Blocking Peptide
33R-9738 100 ug

Hoxd13 Blocking Peptide

Sign In for Pricing
View Details
Zenocutuzumab ELISA Kit
abx395037 96 Tests

Zenocutuzumab ELISA Kit

Sign In for Pricing
View Details
Depdc1a Recombinant Protein (Mouse)
RP128777 100 µg

Depdc1a Recombinant Protein (Mouse)

Sign In for Pricing
View Details
LOC499980 3'UTR GFP Stable Cell Line
TU260187 1.0 mL

LOC499980 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Klhl26 (NM_172052) Mouse Tagged ORF Clone Lentiviral Particle
MR209001L4V 200 µL

Klhl26 (NM_172052) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details