Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4497 mimic
HY-R01106-01 5 nmol

Hsa-miR-4497 mimic

Sign In for Pricing
View Details
Hsa-miR-4497 mimic
HY-R01106-02 20 nmol

Hsa-miR-4497 mimic

Sign In for Pricing
View Details
Human SCGB2A2 (Secretoglobin Family 2A, Member 2) ELISA Kit
EK243369 96 Well

Human SCGB2A2 (Secretoglobin Family 2A, Member 2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal STARD3 Antibody
NBP3-21243-25ul 25 µL

Rabbit Polyclonal STARD3 Antibody

Sign In for Pricing
View Details
Teddm3 (NM_025634) Mouse Untagged Clone
MC210393 10 µg

Teddm3 (NM_025634) Mouse Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal Adenylosuccinate Lyase Antibody (05) [Janelia Fluor 669]
NBP3-26085JF669 0.1 mL

Mouse Monoclonal Adenylosuccinate Lyase Antibody (05) [Janelia Fluor 669]

Sign In for Pricing
View Details