Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubie3 shRNA (m) Lentiviral Particles
sc-154862-V 200 µL

Ubie3 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
SHROOM1, CT (APXL2, Protein Shroom1, Apical Protein 2)
352513 100 µg

SHROOM1, CT (APXL2, Protein Shroom1, Apical Protein 2)

Sign In for Pricing
View Details
Human OAT Antibody (Biotin Conjugate)
34036-05121 150 µg

Human OAT Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
C12orf40 siRNA (Human)
MBS8200929-01 15 nmol

C12orf40 siRNA (Human)

Sign In for Pricing
View Details
C12orf40 siRNA (Human)
MBS8200929-02 30 nmol

C12orf40 siRNA (Human)

Sign In for Pricing
View Details
C12orf40 siRNA (Human)
MBS8200929-03 5x 30 nmol

C12orf40 siRNA (Human)

Sign In for Pricing
View Details