Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIG3, Human (His)

PIG3 is a key player in cellular processes, functioning as an enzyme that catalyzes NADPH-dependent quinone reduction. It exhibits moderate enzymatic activity towards β-naphthoquinone, with the para -quinone isomer (1,2-β-naphthoquinone) compared to the para -isomer (1,4-β-naphthoquinone) . Obvious preference. PIG3 Protein, Human (His) is the recombinant human-derived PIG3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PIG3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pig3-protein-human-his.html

Purity

94.20

Smiles

MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

Molecular Formula

9540 (Gene_ID) Q53FA7 (M1-Q332) (Accession)

Molecular Weight

Approximately 37.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSBPL9 (NM_148908) Human 3' UTR Clone
SC208937 10 µg

OSBPL9 (NM_148908) Human 3' UTR Clone

Sign In for Pricing
View Details
GENLISA™ Human Transmembrane Protease Serine 6 (TMPRSS6) ELISA
KBH6312 1x 96 Well

GENLISA™ Human Transmembrane Protease Serine 6 (TMPRSS6) ELISA

Sign In for Pricing
View Details
HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (AP)
MBS6163359-01 0.1 mL

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (AP)

Sign In for Pricing
View Details
HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (AP)
MBS6163359-02 5x 0.1 mL

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (AP)

Sign In for Pricing
View Details
DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (HRP)
MBS6179675-01 0.1 mL

DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (HRP)

Sign In for Pricing
View Details
DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (HRP)
MBS6179675-02 5x 0.1 mL

DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (HRP)

Sign In for Pricing
View Details