Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 epsilon, Human (104a.a, HEK293, Fc)

CD3 epsilon is an important component of the TCR-CD3 complex on T lymphocytes and promotes TCR-mediated signaling. When APC activates the TCR, CD3 epsilon, together with CD3D, CD3G, and CD3Z, transmits signals across the cell membrane through ITAMs. CD3 epsilon Protein, Human (104a.a, HEK293, Fc) is the recombinant human-derived CD3 epsilon protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD3 epsilon Protein, Human (104a.a, HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-epsilon-protein-human-hek-293-fc.html

Purity

98.0

Smiles

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Molecular Formula

916 (Gene_ID) P07766 (D23-D126) (Accession)

Molecular Weight

40-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASZ1 Recombinant Protein (Mouse)
RP117659 100 µg

ASZ1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
N-azidoacetylmannosamine
C51519-25MG 1 Unit

N-azidoacetylmannosamine

Sign In for Pricing
View Details
Rabbit Cell division cycle associated protein 2 (CDCA2) ELISA Kit
GTR10333451 96 Well

Rabbit Cell division cycle associated protein 2 (CDCA2) ELISA Kit

Sign In for Pricing
View Details
Porcine FGF19 (Fibroblast growth factor 19) ELISA Kit
MBS7607122-01 48 Well

Porcine FGF19 (Fibroblast growth factor 19) ELISA Kit

Sign In for Pricing
View Details
Porcine FGF19 (Fibroblast growth factor 19) ELISA Kit
MBS7607122-02 96 Well

Porcine FGF19 (Fibroblast growth factor 19) ELISA Kit

Sign In for Pricing
View Details
Porcine FGF19 (Fibroblast growth factor 19) ELISA Kit
MBS7607122-03 5x 96 Well

Porcine FGF19 (Fibroblast growth factor 19) ELISA Kit

Sign In for Pricing
View Details