Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUMF1, Human (HEK293, His)

The SUMF1 protein plays an important role as an oxidase that converts cysteine to 3-oxoalanine on specific target proteins such as GALNS, ARSA, STS, and ARSE. This enzymatic activity is essential for the maturation of arylsulfatase and alkaline phosphatase, leading to the formation of 3-oxoalanine (fGly) . SUMF1 Protein, Human (HEK293, His) is the recombinant human-derived SUMF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SUMF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sumf1-protein-human-hek-293-his.html

Purity

98.0

Smiles

SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD

Molecular Formula

285362 (Gene_ID) Q8NBK3-1 (S34-D374) (Accession)

Molecular Weight

38-42 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human E2F7 Protein, N-His
bs-104840P-01 20 µg

Recombinant Human E2F7 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human E2F7 Protein, N-His
bs-104840P-02 50 µg

Recombinant Human E2F7 Protein, N-His

Sign In for Pricing
View Details
NFκB-p105/p50 (phospho Ser337) Polyclonal Antibody
RA27786-01 50 µL

NFκB-p105/p50 (phospho Ser337) Polyclonal Antibody

Sign In for Pricing
View Details
NFκB-p105/p50 (phospho Ser337) Polyclonal Antibody
RA27786-02 100 µL

NFκB-p105/p50 (phospho Ser337) Polyclonal Antibody

Sign In for Pricing
View Details
Human ISL LIM Homeobox Protein 1 (ISL1) CLIA Kit
abx495808-01 96 Tests

Human ISL LIM Homeobox Protein 1 (ISL1) CLIA Kit

Sign In for Pricing
View Details
Human ISL LIM Homeobox Protein 1 (ISL1) CLIA Kit
abx495808-02 5x 96 Tests

Human ISL LIM Homeobox Protein 1 (ISL1) CLIA Kit

Sign In for Pricing
View Details