Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Eukaryotic peptide chain release factor subunit 1 (SUP45), partial

Product Specifications

Product Name Alternative

(Eukaryotic release factor 1) (eRF1) (Omnipotent suppressor protein 1)

Abbreviation

Recombinant Saccharomyces cerevisiae SUP45 protein, partial

Gene Name

SUP45

UniProt

P12385

Expression Region

26-262aa

Organism

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Target Sequence

GNGTSMISLVIPPKGQIPLYQKMLTDEYGTASNIKSRVNRLSVLSAITSTQQKLKLYNTLPKNGLVLYCGDIITEDGKEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLQADDKFGFIVMDGQGTLFGSVSGNTRTVLHKFTVDLPKKHGRGGQSALRFARLREEKRHNYVRKVAEVAVQNFITNDKVNVKGLILAGSADFKTDLAKSELFDPRLACKVISIVDVSYGGENGFN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUVB2 Mouse Monoclonal Antibody [A1E12]
EM1901-58 100 µL

RUVB2 Mouse Monoclonal Antibody [A1E12]

Sign In for Pricing
View Details
PPP2R1B (NM_181699) Human Over-expression Lysate
LC403624 20 µg

PPP2R1B (NM_181699) Human Over-expression Lysate

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (MS4A1/3409), CF405S conjugate, 0.1mg/mL
BNC043409-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (MS4A1/3409), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PKA RI alpha Antibody
RC-4868-01 50 μL

Recombinant PKA RI alpha Antibody

Sign In for Pricing
View Details
Recombinant PKA RI alpha Antibody
RC-4868-02 100 µL

Recombinant PKA RI alpha Antibody

Sign In for Pricing
View Details
Recombinant PKA RI alpha Antibody
RC-4868-03 1 mL

Recombinant PKA RI alpha Antibody

Sign In for Pricing
View Details