Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial

Product Specifications

Product Name Alternative

CDw116; CD116

Abbreviation

Recombinant Human CSF2RA protein, partial

Gene Name

CSF2RA

UniProt

P15509

Expression Region

23-320aa

Organism

Homo sapiens (Human)

Target Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hatopoietic cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

63.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPK1 Recombinant Protein (Human)
RP016435 100 µg

ITPK1 Recombinant Protein (Human)

Sign In for Pricing
View Details
RN5S265 Recombinant Protein (Human)
RP087486 100 µg

RN5S265 Recombinant Protein (Human)

Sign In for Pricing
View Details
Brilliant Violet 605™ anti-human CD163
GT11006 25 Tests

Brilliant Violet 605™ anti-human CD163

Sign In for Pricing
View Details
Human ARFGEF2 Knockout HEK293T cell line
GTR15406032 1 Vial

Human ARFGEF2 Knockout HEK293T cell line

Sign In for Pricing
View Details
Csnk1d Rat shRNA Lentiviral Particle (Locus ID 64462)
TL712987V 500 µL Each

Csnk1d Rat shRNA Lentiviral Particle (Locus ID 64462)

Sign In for Pricing
View Details
C17orf59 CRISPR/Cas9 KO Plasmid (h)
sc-412334 20 µg

C17orf59 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details