Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Mouse (His)

IGF-I/IGF-1 Protein, Mouse (His) is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF1 also mediates neuroprotective mechanism.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-mouse-his.html

Purity

98.0

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Formula

16000 (Gene_ID) P05017-1 (G49-A118) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richman C, et, al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140 (10) :4699-705.|[2]Carlson SW, et, al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35 (13) :1467-1480.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Muricholic Acid Glucuronide Conjugate 4
TRC-M234673-1MG 1 mg

Beta-Muricholic Acid Glucuronide Conjugate 4

Sign In for Pricing
View Details
TRIM44 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C2]
TA505560BM 100 µL

TRIM44 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C2]

Sign In for Pricing
View Details
Cholestane-3Beta,5Alpha,6Alpha-triol
TRC-C431745-1G 1 g

Cholestane-3Beta,5Alpha,6Alpha-triol

Sign In for Pricing
View Details
DCAF4L2 Human Gene Knockout Kit (CRISPR)
KN422673 1 Kit

DCAF4L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AzoDye-2 Carboxylic Acid
2420-AAT 25 mg

AzoDye-2 Carboxylic Acid

Sign In for Pricing
View Details
CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF568 conjugate, 0.1mg/mL
BNC681654-100 1x 100 µL

CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details