Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Mouse (His)

IGF-I/IGF-1 Protein, Mouse (His) is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF1 also mediates neuroprotective mechanism.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-mouse-his.html

Purity

98.0

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Formula

16000 (Gene_ID) P05017-1 (G49-A118) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richman C, et, al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140 (10) :4699-705.|[2]Carlson SW, et, al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35 (13) :1467-1480.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trophinin (TRO) Rabbit Polyclonal Antibody
TA370679 100 µL

Trophinin (TRO) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Disabled Homolog 1 (DAB1) ELISA Kit
RD-DAB1-Ra-01 96 Tests

Rat Disabled Homolog 1 (DAB1) ELISA Kit

Sign In for Pricing
View Details
Rat Disabled Homolog 1 (DAB1) ELISA Kit
RD-DAB1-Ra-02 48 Tests

Rat Disabled Homolog 1 (DAB1) ELISA Kit

Sign In for Pricing
View Details
CEP170 Rabbit Polyclonal Antibody
TA372223 100 µL

CEP170 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS502366 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details