Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Mouse (His)

IGF-I/IGF-1 Protein, Mouse (His) is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF1 also mediates neuroprotective mechanism.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-mouse-his.html

Purity

98.0

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Formula

16000 (Gene_ID) P05017-1 (G49-A118) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richman C, et, al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140 (10) :4699-705.|[2]Carlson SW, et, al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35 (13) :1467-1480.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D (Tumor Marker) (CTSD/2781), CF405S conjugate, 0.1mg/mL
BNC042781-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/2781), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acetylcholine Bromide
TRC-A172073-5G 5 g

Acetylcholine Bromide

Sign In for Pricing
View Details
SHMT1 (NM_004169) Human Over-expression Lysate
LY401341 100 µg

SHMT1 (NM_004169) Human Over-expression Lysate

Sign In for Pricing
View Details
Glycophorin A Rabbit Polyclonal Antibody
0806-7 100 µL

Glycophorin A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Noggin/NOG, Tag Free
HA211281-01 20 µg

Mouse Noggin/NOG, Tag Free

Sign In for Pricing
View Details
Mouse Noggin/NOG, Tag Free
HA211281-02 50 µg

Mouse Noggin/NOG, Tag Free

Sign In for Pricing
View Details