Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crotalus atrox Phospholipase A2, partial

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

Abbreviation

Recombinant Crotalus atrox Phospholipase A2 protein, partial

UniProt

P0CV89

Expression Region

1-61aa

Organism

Crotalus atrox (Western diamondback rattlesnake)

Target Sequence

NLLQFNKMIKIMTKKNAFPFYTSYGCYCGWGGRCCFVHDCCYEKTDIYSYSWKRQICECDR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Snake venom phospholipase A2 (PLA2) that displays edema-inducing activities. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.8 kDa

References & Citations

"Exploring the venom proteome of the western diamondback rattlesnake, Crotalus atrox, via snake venomics and combinatorial peptide ligand library approaches." Calvete J.J., Fasoli E., Sanz L., Boschetti E., Righetti P.G. J. Proteome Res. 8:3055-3067 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4E Rabbit Polyclonal Antibody
AP20976PU-N 100 µg

EIF4E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM53 (NM_001300746) Human Tagged ORF Clone
RG236538 10 µg

TMEM53 (NM_001300746) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human KHDC1L activation kit by CRISPRa
GA119086 1 Kit

Human KHDC1L activation kit by CRISPRa

Sign In for Pricing
View Details
OR4D2 (C-term) Rabbit Polyclonal Antibody
AP53051PU-N 400 µL

OR4D2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD59 Polyclonal Antibody
D-AB-10258L-01 25 µL

CD59 Polyclonal Antibody

Sign In for Pricing
View Details
CD59 Polyclonal Antibody
D-AB-10258L-02 100 µL

CD59 Polyclonal Antibody

Sign In for Pricing
View Details