Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEC/CCL28, Rat

MEC/CCL28 Protein, Rat is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Rat is a recombinant rat MEC/CCL28 (S20-R135) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MEC/CCL28 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mec-ccl28-protein-rat.html

Purity

95.00

Smiles

SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR

Molecular Formula

114492 (Gene_ID) Q91Y39 (S20-R135) (Accession)

Molecular Weight

Approximately 17.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Meurens F, et al. Expression of mucosal chemokines TECK/CCL25 and MEC/CCL28 during fetal development of the ovine mucosal immune system. Immunology. 2007 Apr;120 (4) :544-55.|[2]Hiroyuki Ogawa, et al. Regulated production of the chemokine CCL28 in human colon epithelium. Am J Physiol Gastrointest Liver Physiol. 2004 Nov;287 (5) :G1062-9.|[3]Teena Mohan, et al. CCL28 chemokine: An anchoring point bridging innate and adaptive immunity. Int Immunopharmacol. 2017 Oct;51:165-170.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD44 variant 6 Antibody (CD44v6/1246) [Alexa Fluor 647]
NBP2-54572AF647 100 µL

Mouse Monoclonal CD44 variant 6 Antibody (CD44v6/1246) [Alexa Fluor 647]

Sign In for Pricing
View Details
Lentiviral human LIPJ shRNA (UAS) - Lentiviral human LIPJ shRNA (UAS, RFP) (100)
GTR15128592 1 Vial

Lentiviral human LIPJ shRNA (UAS) - Lentiviral human LIPJ shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CLIM-2 shRNA Plasmid (h)
sc-35072-SH 20 µg

CLIM-2 shRNA Plasmid (h)

Sign In for Pricing
View Details
Human Anti M2A IgG2a Antibody ELISA kit
GTR10437223 96 Well

Human Anti M2A IgG2a Antibody ELISA kit

Sign In for Pricing
View Details
β-Casomorphin-5 (Bovine)
PEK-4079-V 0.5 mg

β-Casomorphin-5 (Bovine)

Sign In for Pricing
View Details
Mouse anti lupus anticoagulant antibody (IgG) ELISA kit
GTR10374445 96 Well

Mouse anti lupus anticoagulant antibody (IgG) ELISA kit

Sign In for Pricing
View Details