Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEC/CCL28, Rat

MEC/CCL28 Protein, Rat is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Rat is a recombinant rat MEC/CCL28 (S20-R135) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MEC/CCL28 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mec-ccl28-protein-rat.html

Purity

95.00

Smiles

SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR

Molecular Formula

114492 (Gene_ID) Q91Y39 (S20-R135) (Accession)

Molecular Weight

Approximately 17.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Meurens F, et al. Expression of mucosal chemokines TECK/CCL25 and MEC/CCL28 during fetal development of the ovine mucosal immune system. Immunology. 2007 Apr;120 (4) :544-55.|[2]Hiroyuki Ogawa, et al. Regulated production of the chemokine CCL28 in human colon epithelium. Am J Physiol Gastrointest Liver Physiol. 2004 Nov;287 (5) :G1062-9.|[3]Teena Mohan, et al. CCL28 chemokine: An anchoring point bridging innate and adaptive immunity. Int Immunopharmacol. 2017 Oct;51:165-170.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nfe2l1 (NM_001130450) Mouse Tagged Lenti ORF Clone
MR226831L4 10 µg

Nfe2l1 (NM_001130450) Mouse Tagged Lenti ORF Clone

Ask
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Flagellar biosynthetic protein fliR (fliR), partial
MBS7093175 Inquire

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Flagellar biosynthetic protein fliR (fliR), partial

Ask
View Details
Monkey neuromedin B (NMB) ELISA Kit
MBS7238115-01 48 Well

Monkey neuromedin B (NMB) ELISA Kit

Ask
View Details
Monkey neuromedin B (NMB) ELISA Kit
MBS7238115-02 96 Well

Monkey neuromedin B (NMB) ELISA Kit

Ask
View Details
Monkey neuromedin B (NMB) ELISA Kit
MBS7238115-03 5x 96 Well

Monkey neuromedin B (NMB) ELISA Kit

Ask
View Details
Monkey neuromedin B (NMB) ELISA Kit
MBS7238115-04 10x 96 Well

Monkey neuromedin B (NMB) ELISA Kit

Ask
View Details