Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEC/CCL28, Rat

MEC/CCL28 Protein, Rat is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Rat is a recombinant rat MEC/CCL28 (S20-R135) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MEC/CCL28 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mec-ccl28-protein-rat.html

Purity

95.00

Smiles

SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR

Molecular Formula

114492 (Gene_ID) Q91Y39 (S20-R135) (Accession)

Molecular Weight

Approximately 17.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Meurens F, et al. Expression of mucosal chemokines TECK/CCL25 and MEC/CCL28 during fetal development of the ovine mucosal immune system. Immunology. 2007 Apr;120 (4) :544-55.|[2]Hiroyuki Ogawa, et al. Regulated production of the chemokine CCL28 in human colon epithelium. Am J Physiol Gastrointest Liver Physiol. 2004 Nov;287 (5) :G1062-9.|[3]Teena Mohan, et al. CCL28 chemokine: An anchoring point bridging innate and adaptive immunity. Int Immunopharmacol. 2017 Oct;51:165-170.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKD2 Protein Lysate (Mouse) with C-HA Tag
36871034 100 µg

PKD2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Cyclic AMP
M18885-01 200 mg

Cyclic AMP

Sign In for Pricing
View Details
Cyclic AMP
M18885-02 500 mg

Cyclic AMP

Sign In for Pricing
View Details
Cyclic AMP
M18885-03 1 g

Cyclic AMP

Sign In for Pricing
View Details
Lentiviral human LYSMD3 shRNA (UAS) - Lentiviral human LYSMD3 shRNA (UAS) plasmid
GTR15118339 1 Vial

Lentiviral human LYSMD3 shRNA (UAS) - Lentiviral human LYSMD3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
REG3A, NT (REG3A, HIP, PAP, PAP1, Regenerating islet-derived protein 3-alpha, Human proislet peptide, Pancreatitis-associated protein 1, Regenerating islet-derived protein III-alpha) (Azide free) (HRP)
MBS6341228-01 0.2 mL

REG3A, NT (REG3A, HIP, PAP, PAP1, Regenerating islet-derived protein 3-alpha, Human proislet peptide, Pancreatitis-associated protein 1, Regenerating islet-derived protein III-alpha) (Azide free) (HRP)

Sign In for Pricing
View Details