Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEC/CCL28, Rat

MEC/CCL28 Protein, Rat is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Rat is a recombinant rat MEC/CCL28 (S20-R135) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MEC/CCL28 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mec-ccl28-protein-rat.html

Purity

95.00

Smiles

SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR

Molecular Formula

114492 (Gene_ID) Q91Y39 (S20-R135) (Accession)

Molecular Weight

Approximately 17.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Meurens F, et al. Expression of mucosal chemokines TECK/CCL25 and MEC/CCL28 during fetal development of the ovine mucosal immune system. Immunology. 2007 Apr;120 (4) :544-55.|[2]Hiroyuki Ogawa, et al. Regulated production of the chemokine CCL28 in human colon epithelium. Am J Physiol Gastrointest Liver Physiol. 2004 Nov;287 (5) :G1062-9.|[3]Teena Mohan, et al. CCL28 chemokine: An anchoring point bridging innate and adaptive immunity. Int Immunopharmacol. 2017 Oct;51:165-170.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Skint8 shRNA (UAS) - Lentiviral mouse Skint8 shRNA (UAS, iRFP) plasmid
GTR15306079 1 Vial

Lentiviral mouse Skint8 shRNA (UAS) - Lentiviral mouse Skint8 shRNA (UAS, iRFP) plasmid

Ask
View Details
CAB39L (Calcium-binding Protein 39-like, Antigen MLAA-34, MO25beta, Mo25-like Protein, FLJ12577) (MaxLight 490)
124197-ML490 100 µL

CAB39L (Calcium-binding Protein 39-like, Antigen MLAA-34, MO25beta, Mo25-like Protein, FLJ12577) (MaxLight 490)

Ask
View Details
Mouse Monoclonal BID Antibody (OTI1G10) [Biotin]
NBP2-70254B 0.1 mL

Mouse Monoclonal BID Antibody (OTI1G10) [Biotin]

Ask
View Details
Lamp2 (NM_010685) Mouse Tagged ORF Clone Lentiviral Particle
MR222875L3V 200 µL

Lamp2 (NM_010685) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
EphA7, CT (EPHA7, EHK3, HEK11, Ephrin type-A receptor 7, EPH homology kinase 3, EPH-like kinase 11) (MaxLight 750) discontinued
035120-ML750 100 µL

EphA7, CT (EPHA7, EHK3, HEK11, Ephrin type-A receptor 7, EPH homology kinase 3, EPH-like kinase 11) (MaxLight 750) discontinued

Ask
View Details