Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphotoxin-alpha (LTA), partial, Biotinylated

Product Specifications

Product Name Alternative

(LT-alpha) (TNF-beta) (Tumor necrosis factor ligand superfamily member 1)

Abbreviation

Recombinant Human LTA protein, partial, Biotinylated

Gene Name

LTA

UniProt

P01374

Expression Region

35-205aa

Organism

Homo sapiens (Human)

Target Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Tag

N-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.7 kDa

References & Citations

"Tumor necrosis factor gene complex in COPD and disseminated bronchiectasis." Patuzzo C., Gile L.S., Zorzetto M., Trabetti E., Malerba G., Pignatti P.F., Luisetti M. Chest 117:1353-1358 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WT1 (Wilm's Tumor 1) (WT1/857), CF647 conjugate, 0.1mg/mL
BNC470857-100 1x 100 µL

WT1 (Wilm's Tumor 1) (WT1/857), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium 2,2-Dichloroacetate-2-13C
TRC-D431839-1MG 1 mg

Sodium 2,2-Dichloroacetate-2-13C

Sign In for Pricing
View Details
LRRTM1 Antibody
KC-8011-01 50 μL

LRRTM1 Antibody

Sign In for Pricing
View Details
LRRTM1 Antibody
KC-8011-02 100 µL

LRRTM1 Antibody

Sign In for Pricing
View Details
LRRTM1 Antibody
KC-8011-03 1 mL

LRRTM1 Antibody

Sign In for Pricing
View Details
Cntnap5c Mouse Gene Knockout Kit (CRISPR)
KN503593 1 Kit

Cntnap5c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details