Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (His)

The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress. GDF-15 Protein, Mouse (His) is the recombinant mouse-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-his.html

Purity

90.0

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7-1 (S189-A303) (Accession)

Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), 1mg/mL
BNUM1527-50 1x 50 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), 1mg/mL

Sign In for Pricing
View Details
(+)-[6]-Gingerol
TRC-G387205-10MG 10 mg

(+)-[6]-Gingerol

Sign In for Pricing
View Details
MAGP1 (MFAP2) (NM_001135247) Human Recombinant Protein
TP325196L 1 mg

MAGP1 (MFAP2) (NM_001135247) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Elongation Factor 1A1 Antibody
RC-15970-01 50 μL

Recombinant Elongation Factor 1A1 Antibody

Sign In for Pricing
View Details
Recombinant Elongation Factor 1A1 Antibody
RC-15970-02 100 µL

Recombinant Elongation Factor 1A1 Antibody

Sign In for Pricing
View Details
Recombinant Elongation Factor 1A1 Antibody
RC-15970-03 1 mL

Recombinant Elongation Factor 1A1 Antibody

Sign In for Pricing
View Details