Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prostaglandin E synthase (Ptges)

Product Specifications

Product Name Alternative

Microsomal prostaglandin E synthase 1 (mPGES-1) (Pges)

Abbreviation

Recombinant Mouse Ptges protein

Gene Name

Ptges

UniProt

Q9JM51

Expression Region

1-153aa

Organism

Mus musculus (Mouse)

Target Sequence

MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL

Tag

N-terminal 10xHis-SUMO-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Signal Transduction

Relevance

Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 to prostaglandin E2.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.8 kDa

References & Citations

"The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y. Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gpat4 (NM_018743) AAV Particle
MR207278A1V 250 µL

Mouse Gpat4 (NM_018743) AAV Particle

Sign In for Pricing
View Details
2-Chloro-4- (trifluoromethyl) phenol
FC64432-01 25 g

2-Chloro-4- (trifluoromethyl) phenol

Sign In for Pricing
View Details
2-Chloro-4- (trifluoromethyl) phenol
FC64432-02 50 g

2-Chloro-4- (trifluoromethyl) phenol

Sign In for Pricing
View Details
2-Chloro-4- (trifluoromethyl) phenol
FC64432-03 100 g

2-Chloro-4- (trifluoromethyl) phenol

Sign In for Pricing
View Details
2-Chloro-4- (trifluoromethyl) phenol
FC64432-04 250 g

2-Chloro-4- (trifluoromethyl) phenol

Sign In for Pricing
View Details
2-Chloro-4- (trifluoromethyl) phenol
FC64432-05 500 g

2-Chloro-4- (trifluoromethyl) phenol

Sign In for Pricing
View Details