Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Formimidoyltransferase-cyclodeaminase (FTCD)

Product Specifications

Product Name Alternative

(Formiminotransferase-cyclodeaminase) (FTCD) (LCHC1) (Glutamate formimidoyltransferase) (Glutamate formiminotransferase) (Glutamate formyltransferase) (Formimidoyltetrahydrofolate cyclodeaminase) (Formiminotetrahydrofolate cyclodeaminase)

Abbreviation

Recombinant Human FTCD protein

Gene Name

FTCD

UniProt

O95954

Expression Region

1-541aa

Organism

Homo sapiens (Human)

Target Sequence

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool.; Binds and promotes bundling of vimentin filaments originating from the Golgi.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

65.0 kDa

References & Citations

"Using a yeast two-hybrid system to identify FTCD as a new regulator for HIF-1alpha in HepG2 cells." Yu Z., Ge Y., Xie L., Zhang T., Huang L., Zhao X., Liu J., Huang G. Cell Signal 26:1560-1566 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human NGLY1 pAb
PA9532-01 50 μL

Rabbit Anti-Human NGLY1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human NGLY1 pAb
PA9532-02 100 μL

Rabbit Anti-Human NGLY1 pAb

Sign In for Pricing
View Details
FDFT1 (SS, SQS, DGPT, ERG9, Farnesyl-diphosphate Farnesyltransferase) (HRP).
MBS6446540-01 0.1 mL

FDFT1 (SS, SQS, DGPT, ERG9, Farnesyl-diphosphate Farnesyltransferase) (HRP).

Sign In for Pricing
View Details
FDFT1 (SS, SQS, DGPT, ERG9, Farnesyl-diphosphate Farnesyltransferase) (HRP).
MBS6446540-02 5x 0.1 mL

FDFT1 (SS, SQS, DGPT, ERG9, Farnesyl-diphosphate Farnesyltransferase) (HRP).

Sign In for Pricing
View Details
Recombinant Hepatitis delta virus genotype I Small delta antigen
orb2658839-01 20 µg

Recombinant Hepatitis delta virus genotype I Small delta antigen

Sign In for Pricing
View Details
Recombinant Hepatitis delta virus genotype I Small delta antigen
orb2658839-02 100 µg

Recombinant Hepatitis delta virus genotype I Small delta antigen

Sign In for Pricing
View Details