Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuronal pentraxin-1 (Nptx1), partial

Product Specifications

Product Name Alternative

(NP1) (Neuronal pentraxin I) (NP-I)

Abbreviation

Recombinant Mouse Nptx1 protein, partial

Gene Name

Nptx1

UniProt

Q62443

Expression Region

23-432aa

Organism

Mus musculus (Mouse)

Target Sequence

QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSNVLQLRETVLQQKETILSQKETIRELTTKLGRCESQSTLDSGPGEARSGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSRVNTLEEGKGGPKNDTEERAKIESALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSSKALSGNVIAWAESQIEIFGGATKWTFEACRQIN

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

May be involved in mediating uptake of synaptic material during synapse remodeling or in mediating the synaptic clustering of AMPA glutamate receptors at a subset of excitatory synapses.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

73.9 kDa

References & Citations

"Biochemical interactions of the neuronal pentraxins. Neuronal pentraxin (NP) receptor binds to taipoxin and taipoxin-associated calcium-binding protein 49 via NP1 and NP2." Kirkpatrick L.L., Matzuk M.M., Dodds D.C., Perin M.S. J. Biol. Chem. 275:17786-17792 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS507969 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Phospho-KAP1 (S824) Recombinant Rabbit Monoclonal Antibody [JE50-99]
ET7110-11 100 µL

Phospho-KAP1 (S824) Recombinant Rabbit Monoclonal Antibody [JE50-99]

Sign In for Pricing
View Details
BCL2L14 Polyclonal Antibody
E-AB-10865-01 20 µL

BCL2L14 Polyclonal Antibody

Sign In for Pricing
View Details
BCL2L14 Polyclonal Antibody
E-AB-10865-02 60 µL

BCL2L14 Polyclonal Antibody

Sign In for Pricing
View Details
BCL2L14 Polyclonal Antibody
E-AB-10865-03 120 µL

BCL2L14 Polyclonal Antibody

Sign In for Pricing
View Details
BCL2L14 Polyclonal Antibody
E-AB-10865-04 200 µL

BCL2L14 Polyclonal Antibody

Sign In for Pricing
View Details