Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Immediate-early protein 1 (U90/U89), partial

Product Specifications

Product Name Alternative

Protein RF2/RF3/RF4; pRF2/pRF3/pRF4

Abbreviation

Recombinant Human herpesvirus 6A U90/U89 protein, partial

Gene Name

U90/U89

UniProt

Q69567

Expression Region

665-941aa

Organism

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Target Sequence

KSESDSESSSESNDCTSEHKQLHLSDYDEVTNNGHCPSYGFPTPVFTIPIRSMQGTGGIKSKFIPKKNWIWYMKKTHQVDNCPIHNSENVDAKDDSDGTEAKHCFMNHFVPIKTDDEDYDKNNVSYIYNKIQNSKIDSGDIIPTKKLIIDMVMDNFMDLNDIIKQGITKHCQDLCNKYNVVTPTTCEDDLNMTNSQTFATTATQVFDPPVTGNNSSILNIINDTTSQNDENRCTEGTSNSNEKCTNISDCNSDGTEAFKLDGYPSDYDPFVENAQIY

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF594 conjugate, 0.1mg/mL
BNC942053-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC3 (Mucin 3) (MUC3/2992R), CF640R conjugate, 0.1mg/mL
BNC402992-100 1x 100 µL

MUC3 (Mucin 3) (MUC3/2992R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-500 1x 500 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-500 1x 500 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF488A conjugate, 0.1mg/mL
BNC881600-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053 + L1C1), CF640R conjugate, 0.1mg/mL
BNC400755-100 1x 100 µL

Human Kappa Light Chain (HP6053 + L1C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details