Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insulin-like 3/INSL3, Human (HEK293, His)

Insulin-like 3/INSL3 Protein, Human (HEK293, His) is the recombinant human-derived Insulin-like 3/INSL3 protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

Insulin-like 3/INSL3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insulin-like-3-insl3-protein-human-hek-293-his.html

Purity

95.00

Smiles

LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY

Molecular Formula

3640 (Gene_ID) AAI06722.1 (L21-Y131) (Accession)

Molecular Weight

13-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
TA378265 100 µL

NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR560593 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Cytochrome P450 3A1 / CYP3A1 (P6), CF405S conjugate, 0.1mg/mL
BNC043058-100 1x 100 µL

Cytochrome P450 3A1 / CYP3A1 (P6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF488A conjugate, 0.1mg/mL
BNC882597-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LRRC66 activation kit by CRISPRa
GA117453 1 Kit

Human LRRC66 activation kit by CRISPRa

Sign In for Pricing
View Details
CALCA Antibody
KC-1690-01 50 μL

CALCA Antibody

Sign In for Pricing
View Details