Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human

FGF-4 Protein is an important member of the fibroblast growth factor (FGF) family. By binding to FGFRs (especially FGFR1 and FGFR2), FGF-4 Protein can activate downstream signaling pathways such as RAS-MAPK and PI3K-AKT. FGF-4 Protein plays a key role in physiological processes such as cell growth, differentiation, migration, and angiogenesis. FGF-4 Protein, Human is a recombinant FGF-4 protein expressed by E. coli without a tag[1][2][3].

Product Specifications

Product Name Alternative

FGF-4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-166a-a.html

Purity

98.0

Smiles

APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (A31-L206) (Accession)

Molecular Weight

Approximately 19-24 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Dell'Era P, et al. Paracrine and autocrine effects of fibroblast growth factor-4 in endothelial cells. Oncogene. 2001 May 10;20 (21) :2655-63.|[2]Zhang W, et al. Capture of Totipotency in Mouse Embryonic Stem Cells in the Absence of Pdzk1. Adv Sci (Weinh) . 2025 Feb;12 (6) :e2408852.|[3]Farré J, et al. FGF-4 increases in vitro expansion rate of human adult bone marrow-derived mesenchymal stem cells. Growth Factors. 2007 Apr;25 (2) :71-6.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Vstm5 (NM_001144870) Rat Tagged ORF Clone
RR202600 10 µg

Vstm5 (NM_001144870) Rat Tagged ORF Clone

Ask
View Details
SP1 (Sp1 Transcription Factor) (MaxLight 490)
251991-ML490 100 µL

SP1 (Sp1 Transcription Factor) (MaxLight 490)

Ask
View Details
CD48 Antibody
R32674 100 µg

CD48 Antibody

Ask
View Details
CPNE6 (NM_001280558) Human Tagged ORF Clone
RG239083 10 µg

CPNE6 (NM_001280558) Human Tagged ORF Clone

Ask
View Details
BR351 precursor 100mg
A20658-100 100 mg

BR351 precursor 100mg

Ask
View Details
Papolb (NM_001012020) Rat Tagged ORF Clone Lentiviral Particle
RR202257L3V 200 µL

Papolb (NM_001012020) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details