Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF121, Human (120 a.a)

VEGF121 Protein, Human (120 a.a), a VEGF isoform splice variant, cannot bind to heparin. VEGF121 Protein is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers.

Product Specifications

Product Name Alternative

VEGF121 Protein, Human (120 a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf121-protein-human-205a-a.html

Purity

98.00

Smiles

PMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-9 (P28-R147) (Accession)

Molecular Weight

Approximately 17 kDa under reduced (R) conditions, 28 kDa under non reducing (N) conditions, based on SDS-PAGE.

References & Citations

[1]Cohen T, et al. VEGF121, a vascular endothelial growth factor (VEGF) isoform lacking heparin binding ability, requires cell-surface heparan sulfates for efficient binding to the VEGF receptors of human melanoma cells. J Biol Chem. 1995 May 12;270 (19) :11322-6.|[2]Broséus J, et al. VEGF121, is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers. Oncotarget. 2017 Jul 19;8 (53) :90808-90824.|[3]Nakatsu MN, et al. VEGF (121) and VEGF (165) regulate blood vessel diameter through vascular endothelial growth factor receptor 2 in an in vitro angiogenesis model. Lab Invest. 2003 Dec;83 (12) :1873-85.|[4]Martini M, et al. VEGF-121 plasma level as biomarker for response to anti-angiogenetic therapy in recurrent glioblastoma. BMC Cancer. 2018 May 10;18 (1) :553.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey IgG (Rhesus, non-immune, isotype control), purified
20012-10 10 mg

Monkey IgG (Rhesus, non-immune, isotype control), purified

Sign In for Pricing
View Details
Rabbit pyridinium crosslink / PyriLinks (PY) ELISA Kit
MBS2600289-01 48 Well

Rabbit pyridinium crosslink / PyriLinks (PY) ELISA Kit

Sign In for Pricing
View Details
Rabbit pyridinium crosslink / PyriLinks (PY) ELISA Kit
MBS2600289-02 96 Well

Rabbit pyridinium crosslink / PyriLinks (PY) ELISA Kit

Sign In for Pricing
View Details
Rabbit pyridinium crosslink / PyriLinks (PY) ELISA Kit
MBS2600289-03 5x 96 Well

Rabbit pyridinium crosslink / PyriLinks (PY) ELISA Kit

Sign In for Pricing
View Details
Rabbit pyridinium crosslink / PyriLinks (PY) ELISA Kit
MBS2600289-04 10x 96 Well

Rabbit pyridinium crosslink / PyriLinks (PY) ELISA Kit

Sign In for Pricing
View Details
LOC303215 Protein Lysate (Rat) with C-HA Tag
27111036 100 µg

LOC303215 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details