Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Dipeptidase 1 (DPEP1)

Product Specifications

Product Name Alternative

(Beta-lactamase) (Microsomal dipeptidase)

Abbreviation

Recombinant Sheep DPEP1 protein

Gene Name

DPEP1

UniProt

P43477

Expression Region

17-384aa

Organism

Ovis aries (Sheep)

Target Sequence

DQFRDNAVRLMQSTPVIDGHNDLPWALLKKFNNQLQDPRANLTSLNSTHTNIPKLKAGFVGAQFWSAYTPCDTQNKDSVKRTVEQIDVIQRMCQLYPETFLCVTDSAGIQQAFQEGKVASLVGVEGGHSIDSSLGVLRALYHLGMRYLTLTHSCNTPWADNWLVDTGEDKAQSQGLSSFGQSVVKEMNRLGIIIDLAHVSVATMEAALQLSKAPVIFSHSSAYSLCHHRRNVPDHVLQLVKQTGSLVMVNFYNDYVSCKAEANLSQVADHLDYIKKVAGAGAVGFGGDYDGVSRLPSGLEDVSKYPDLVAELLRRQWTEEEVRGALAENLLRVFKAVEQASDHKQAPGEEPIPLGQLEASCRTKYGYS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Hydrolyzes a wide range of dipeptides. Hydrolyzes the conversion of leukotriene D4 to leukotriene E4. Hydrolyzes cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation. Possesses also beta lactamase activity and hydrolytically inactivates beta-lactam antibiotics.; Independently of its dipeptidase activity, acts as an adhesion receptor for neutrophil recruitment from bloodstream into inflamed lungs and liver.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.3 kDa

References & Citations

"Molecular cloning of sheep lung dipeptidase: a glycosyl phosphatidylinositol-anchored ectoenzyme that converts leukotriene D4 to leukotriene E4." An S., Schmidt F.J., Campbell B.J. Biochim. Biophys. Acta 1226:337-340 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human PRDM11 Antibody-iFluor647 Conjugate
DZ41386-iFluor647 200 µL

Anti-Human PRDM11 Antibody-iFluor647 Conjugate

Sign In for Pricing
View Details
ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)
TRV-0063214-01 24 Tests

ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)

Sign In for Pricing
View Details
ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)
TRV-0063214-02 48 Tests

ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)

Sign In for Pricing
View Details
ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)
TRV-0063214-03 96 Tests

ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)

Sign In for Pricing
View Details
ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)
TRV-0063214-04 5x 96 Tests

ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)

Sign In for Pricing
View Details
ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)
TRV-0063214-05 10x 96 Tests

ELISA Kit for Growth Factor Receptor Bound Protein 2 (Grb2)

Sign In for Pricing
View Details