Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Mouse (His-SUMO)

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-mouse-his-sumo.html

Purity

90.00

Smiles

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

18148 (Gene_ID) Q61937 (M1-L292) (Accession)

Molecular Weight

Approximately 48.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ZC3H12C Protein
E30P9049 20 µg

Recombinant Human ZC3H12C Protein

Sign In for Pricing
View Details
B3galt6 Mouse qPCR Template Standard (NM_080445)
MK202250 1 Kit

B3galt6 Mouse qPCR Template Standard (NM_080445)

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni rpsS Protein (aa 1-93) (strain 81116 / NCTC 11828)
VAng-Ly2423-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni rpsS Protein (aa 1-93) (strain 81116 / NCTC 11828)

Sign In for Pricing
View Details
Human TAB1 Recombinant Protein
PPT-15557 100 µg

Human TAB1 Recombinant Protein

Sign In for Pricing
View Details
Ctla2b Protein Vector (Mouse) (pPM-C-HA)
PV168712 500 ng

Ctla2b Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SARS2 (Seryl-tRNA Synthetase, Mitochondrial, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SerRSmt, SARSM, FLJ20450) (PE)
MBS6393298-01 0.1 mL

SARS2 (Seryl-tRNA Synthetase, Mitochondrial, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SerRSmt, SARSM, FLJ20450) (PE)

Sign In for Pricing
View Details