Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Mouse (His-SUMO)

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-mouse-his-sumo.html

Purity

90.00

Smiles

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

18148 (Gene_ID) Q61937 (M1-L292) (Accession)

Molecular Weight

Approximately 48.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC684741 3'UTR GFP Stable Cell Line
TU261114 1.0 mL

LOC684741 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Canine Interleukin 1 Receptor Type 2 (IL1R2), C-Fc
AP2C34 100 µg

Recombinant Canine Interleukin 1 Receptor Type 2 (IL1R2), C-Fc

Sign In for Pricing
View Details
Anti-CTNNA1 Rabbit pAb
GB111268 100 μL

Anti-CTNNA1 Rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-human POU domain class 2-associating factor 1 polyclonal Antibody, Biotin conjugated
MBS1488982-01 0.05 mg

Rabbit anti-human POU domain class 2-associating factor 1 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human POU domain class 2-associating factor 1 polyclonal Antibody, Biotin conjugated
MBS1488982-02 0.1 mg

Rabbit anti-human POU domain class 2-associating factor 1 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human POU domain class 2-associating factor 1 polyclonal Antibody, Biotin conjugated
MBS1488982-03 5x 0.1 mg

Rabbit anti-human POU domain class 2-associating factor 1 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details