Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Mouse (His-SUMO)

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-mouse-his-sumo.html

Purity

90.00

Smiles

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

18148 (Gene_ID) Q61937 (M1-L292) (Accession)

Molecular Weight

Approximately 48.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Actin, Alpha Skeletal Muscle (ACTA1) ELISA Kit
abx355233-01 10x 96 Tests

Rabbit Actin, Alpha Skeletal Muscle (ACTA1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Actin, Alpha Skeletal Muscle (ACTA1) ELISA Kit
abx355233-02 96 Tests

Rabbit Actin, Alpha Skeletal Muscle (ACTA1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Actin, Alpha Skeletal Muscle (ACTA1) ELISA Kit
abx355233-03 5x 96 Tests

Rabbit Actin, Alpha Skeletal Muscle (ACTA1) ELISA Kit

Sign In for Pricing
View Details
N-Butyl bromide
266151 1 Kg

N-Butyl bromide

Sign In for Pricing
View Details
Lentiviral mouse Mmp9 shRNA (UAS) - Lentiviral mouse Mmp9 shRNA (UAS, RFP) (100)
GTR15232368 1 Vial

Lentiviral mouse Mmp9 shRNA (UAS) - Lentiviral mouse Mmp9 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RNASE11 Mouse Monoclonal Antibody [Clone ID: OTI11E11]
TA810569 100 µL

RNASE11 Mouse Monoclonal Antibody [Clone ID: OTI11E11]

Sign In for Pricing
View Details