Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Mouse (His-SUMO)

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-mouse-his-sumo.html

Purity

90.00

Smiles

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

18148 (Gene_ID) Q61937 (M1-L292) (Accession)

Molecular Weight

Approximately 48.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIT, phosphorylated (Y823) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (Biotin) discontinued
037511-Biotin 200 µL

KIT, phosphorylated (Y823) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (Biotin) discontinued

Sign In for Pricing
View Details
Human MRAP HEK293 Overexpression Lysate
MBS8115495-01 0.3 mg

Human MRAP HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human MRAP HEK293 Overexpression Lysate
MBS8115495-02 5x 0.3 mg

Human MRAP HEK293 Overexpression Lysate

Sign In for Pricing
View Details
STAT5A, Phosphorylated (Y694) (Signal Transducer and Activator of Transcription 5a, STAT5, Mammary Gland Factor, MGF) (AP)
MBS6439245-01 0.1 mL

STAT5A, Phosphorylated (Y694) (Signal Transducer and Activator of Transcription 5a, STAT5, Mammary Gland Factor, MGF) (AP)

Sign In for Pricing
View Details
STAT5A, Phosphorylated (Y694) (Signal Transducer and Activator of Transcription 5a, STAT5, Mammary Gland Factor, MGF) (AP)
MBS6439245-02 5x 0.1 mL

STAT5A, Phosphorylated (Y694) (Signal Transducer and Activator of Transcription 5a, STAT5, Mammary Gland Factor, MGF) (AP)

Sign In for Pricing
View Details
IGDCC3 Human qPCR Template Standard (NM_004884)
HK209592 1 Kit

IGDCC3 Human qPCR Template Standard (NM_004884)

Sign In for Pricing
View Details