Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Mouse (His-SUMO)

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-mouse-his-sumo.html

Purity

90.00

Smiles

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

18148 (Gene_ID) Q61937 (M1-L292) (Accession)

Molecular Weight

Approximately 48.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp90a, Active Human Recombinant Protein
GWB-816F04 200µg

Hsp90a, Active Human Recombinant Protein

Sign In for Pricing
View Details
PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B) (MaxLight 550) discontinued
040338-ML550 100 µL

PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B) (MaxLight 550) discontinued

Sign In for Pricing
View Details
pEnCMV-C10orf55-3×FLAG-SV40-Neo Plasmid
PVT42906 2 µg

pEnCMV-C10orf55-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
KCNMB1 polyclonal antibody
BS74421-01 50 µL

KCNMB1 polyclonal antibody

Sign In for Pricing
View Details
KCNMB1 polyclonal antibody
BS74421-02 100 µL

KCNMB1 polyclonal antibody

Sign In for Pricing
View Details
Mouse Monoclonal FCAR/CD89 Antibody (MIP8a) [Alexa Fluor 750]
NB100-63266AF750 0.1 mL

Mouse Monoclonal FCAR/CD89 Antibody (MIP8a) [Alexa Fluor 750]

Sign In for Pricing
View Details