Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Mouse (His-SUMO)

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-mouse-his-sumo.html

Purity

90.00

Smiles

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

18148 (Gene_ID) Q61937 (M1-L292) (Accession)

Molecular Weight

Approximately 48.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM174 (NM_153217) Human Over-expression Lysate
LY407146 100 µg

TMEM174 (NM_153217) Human Over-expression Lysate

Sign In for Pricing
View Details
HIC5 (TGFB1I1) Human siRNA Oligo Duplex (Locus ID 7041)
SR304806 1 Kit

HIC5 (TGFB1I1) Human siRNA Oligo Duplex (Locus ID 7041)

Sign In for Pricing
View Details
Serum Amyloid A4, Constitutive (SAA4), Recombinant, Human, His-Tag, GST-Tag
055839-01 10 µg

Serum Amyloid A4, Constitutive (SAA4), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
Serum Amyloid A4, Constitutive (SAA4), Recombinant, Human, His-Tag, GST-Tag
055839-02 50 µg

Serum Amyloid A4, Constitutive (SAA4), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
Serum Amyloid A4, Constitutive (SAA4), Recombinant, Human, His-Tag, GST-Tag
055839-03 100 µg

Serum Amyloid A4, Constitutive (SAA4), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
Serum Amyloid A4, Constitutive (SAA4), Recombinant, Human, His-Tag, GST-Tag
055839-04 200 µg

Serum Amyloid A4, Constitutive (SAA4), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details