Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Mouse (His-SUMO)

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-mouse-his-sumo.html

Purity

90.00

Smiles

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

18148 (Gene_ID) Q61937 (M1-L292) (Accession)

Molecular Weight

Approximately 48.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTX2 (Homeobox Protein OTX2, Orthodenticle Homolog 2, CPHD6, MCOPS5) (MaxLight 490)
MBS6430231-01 0.1 mL

OTX2 (Homeobox Protein OTX2, Orthodenticle Homolog 2, CPHD6, MCOPS5) (MaxLight 490)

Sign In for Pricing
View Details
OTX2 (Homeobox Protein OTX2, Orthodenticle Homolog 2, CPHD6, MCOPS5) (MaxLight 490)
MBS6430231-02 5x 0.1 mL

OTX2 (Homeobox Protein OTX2, Orthodenticle Homolog 2, CPHD6, MCOPS5) (MaxLight 490)

Sign In for Pricing
View Details
Tapbp ORF Vector (Rat) (pORF)
ORF077420 1.0 µg DNA

Tapbp ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
SRSF7 Recombinant Protein (Mouse)
RP175550 100 µg

SRSF7 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Poly (L-lactide) 4.0 dl/g
GW3343-10g 10 g

Poly (L-lactide) 4.0 dl/g

Sign In for Pricing
View Details
Goat anti-HIFl-alpha Antibody, Affinity Purified
A303-907A 100 µg

Goat anti-HIFl-alpha Antibody, Affinity Purified

Sign In for Pricing
View Details