Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleophosmin/Npm1, Mouse (His-SUMO)

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleophosmin-npm1-protein-mouse-his-sumo.html

Purity

90.00

Smiles

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Formula

18148 (Gene_ID) Q61937 (M1-L292) (Accession)

Molecular Weight

Approximately 48.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SNW1 Antibody (PCRP-SNW1-2A1) [DyLight 594]
NBP3-26931DL594 0.1 mL

Mouse Monoclonal SNW1 Antibody (PCRP-SNW1-2A1) [DyLight 594]

Sign In for Pricing
View Details
TFIIE beta (GTF2E2) (NM_002095) Human Over-expression Lysate
LY419544 100 µg

TFIIE beta (GTF2E2) (NM_002095) Human Over-expression Lysate

Sign In for Pricing
View Details
ANK1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0086306 1.0 µg DNA

ANK1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Fgb-set siRNA/shRNA/RNAi Lentivector (Rat)
20475096 4x 500 ng

Fgb-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Histone H3 (Di Methyl Lys9) Rabbit Polyclonal Antibody
E28PH0034 100 µL

Histone H3 (Di Methyl Lys9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human KRTAP5-1 Pre-designed siRNA Set A
SI008474A 1 Each

Human KRTAP5-1 Pre-designed siRNA Set A

Sign In for Pricing
View Details