Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Human (127a.a, HEK293, His)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and recruits caspase-8 through FADD to initiate cell apoptosis. It forms the death-inducing signaling complex (DISC), activates caspases and mediates apoptosis. TRAIL R2/TNFRSF10B Protein, Human (127a.a, HEK293, His) is the recombinant human-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Human (127a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-r2-tnfrsf10b-protein-human-hek-293-his.html

Purity

95.0

Smiles

ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Molecular Formula

8795 (Gene_ID) O14763 (I56-E182) (Accession)

Molecular Weight

Approximately 18.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Array, Human, BioAssayTM Hepatocellular carcinoma, grade I ~ III with normal control discontinued
T5596-0731 1Array

Tissue Array, Human, BioAssayTM Hepatocellular carcinoma, grade I ~ III with normal control discontinued

Sign In for Pricing
View Details
Human GID8 Antibody (Biotin Conjugate)
32689-05121 150 µg

Human GID8 Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
Human cholesterol 7α-hydroxylase (CYP7A1) ELISA Kit
YP-W16724-01 48 Tests

Human cholesterol 7α-hydroxylase (CYP7A1) ELISA Kit

Sign In for Pricing
View Details
Human cholesterol 7α-hydroxylase (CYP7A1) ELISA Kit
YP-W16724-02 96 Tests

Human cholesterol 7α-hydroxylase (CYP7A1) ELISA Kit

Sign In for Pricing
View Details
Monkey Homeobox protein Hox-A9 ELISA kit
GTR10439374 96 Well

Monkey Homeobox protein Hox-A9 ELISA kit

Sign In for Pricing
View Details
UBE2D3 (NM_181887) Human Untagged Clone
SC124831 10 µg

UBE2D3 (NM_181887) Human Untagged Clone

Sign In for Pricing
View Details