Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial

Product Specifications

Product Name Alternative

(Serine protease 10) (PRSS10)

Abbreviation

Recombinant Human TMPRSS2 protein, partial

Gene Name

TMPRSS2

UniProt

O15393

Expression Region

106-492aa

Organism

Homo sapiens (Human)

Target Sequence

WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein & Coronavirus Protein

Source

Mammalian cell

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBP (PEBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D4]
TA501616BM 100 µL

PBP (PEBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D4]

Sign In for Pricing
View Details
P73 (Tumor Suppressor) (P73/2531), CF594 conjugate, 0.1mg/mL
BNC942531-500 1x 500 µL

P73 (Tumor Suppressor) (P73/2531), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF405S conjugate, 0.1mg/mL
BNC042697-500 1x 500 µL

PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SR140 (U2SURP) Human Gene Knockout Kit (CRISPR)
KN424434 1 Kit

SR140 (U2SURP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Hydroxy Phenobarbital
TRC-H948960-5MG 5 mg

4-Hydroxy Phenobarbital

Sign In for Pricing
View Details
BSG Rabbit Monoclonal Antibody [Clone ID: 23GB1400]
TA424619 100 µL

BSG Rabbit Monoclonal Antibody [Clone ID: 23GB1400]

Sign In for Pricing
View Details