TREML1, Human (HEK293, His)
Selected Variant
HY-P71382
Size: 1 Each
TREML1 (triggering receptor expressed on myeloid cells, like 1) is a cell surface receptor that may play a role in innate and adaptive immune responses. When phosphorylated, TREML1 interacts with the proteins PTPN6 and PTPN11, suggesting that it may be involved in regulating signaling pathways related to immune processes. TREML1 Protein, Human (HEK293, His) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
TREML1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/treml1-protein-human-hek-293-his.html
Smiles
QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP
Molecular Formula
340205 (Gene_ID) Q86YW5 (Q16-P162) (Accession)
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Price
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/3566), Biotin conjugate, 0.1mg/mL
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF647 conjugate, 0.1mg/mL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF640R conjugate, 0.1mg/mL
HER-2 / CD340 (HRB2/718), CF740 conjugate, 0.1mg/mL
PD1, Mouse (RMP1-14), CF594 conjugate, 0.1mg/mL
