Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Mouse (HEK293, His)

The TM4SF2/TSPAN7 protein may be involved in cell proliferation and motility and play a role in regulating these processes, but the specific mechanism remains unclear. Its involvement in proliferation suggests importance for cell growth, while its role in motility suggests a potential contribution to cell motility and migration. TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-mouse-hek293-his.html

Purity

95.60

Smiles

RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

21912 (Gene_ID) Q62283 (R113-M213) (Accession)

Molecular Weight

Approximately 19-30 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-500 1x 500 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-100 1x 100 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (1415-1), CF405S conjugate, 0.1mg/mL
BNC040580-100 1x 100 µL

Histone H1 (1415-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details