Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCBLD2, Human (HEK293, His)

DCBLD2 Protein is a novel platelet membrane receptor that recruits TRAF6 through EGFR phosphorylation and stimulates AKT to promote tumorigenesis. The DCBLD2 Protein has multiple functions during development as well as in vascular and tumor biology, such as influencing cell proliferation and tumorigenesis. DCBLD2 Protein, Human (HEK293, His) is the recombinant human-derived DCBLD2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DCBLD2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dcbld2-protein-human-hek-293-his.html

Purity

98.0

Smiles

QQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVA

Molecular Formula

131566 (Gene_ID) Q96PD2-1 (Q67-A528) (Accession)

Molecular Weight

80-110 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human ROBO3 shRNA (UAS) - Lentiviral human ROBO3 shRNA (UAS, iRFP) (25)
GTR15312605 1 Vial

Lentiviral human ROBO3 shRNA (UAS) - Lentiviral human ROBO3 shRNA (UAS, iRFP) (25)

Ask
View Details
XYLT1 AAV Vector (Human) (CMV)
50580101 1 µg

XYLT1 AAV Vector (Human) (CMV)

Ask
View Details
MUC1 (EMA, CD227, Breast carcinoma-Associated antigen DF3, CA15-3, Carcinoma-Associated mucin Episialin, Epithelial Membrane Antigen, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1-alpha, MUC1-beta, MUC1-CT, MUC1-NT, MUC1/ZD, Mucin 1 cell surface Asso
MBS6124379-01 0.1 mL

MUC1 (EMA, CD227, Breast carcinoma-Associated antigen DF3, CA15-3, Carcinoma-Associated mucin Episialin, Epithelial Membrane Antigen, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1-alpha, MUC1-beta, MUC1-CT, MUC1-NT, MUC1/ZD, Mucin 1 cell surface Asso

Ask
View Details
MUC1 (EMA, CD227, Breast carcinoma-Associated antigen DF3, CA15-3, Carcinoma-Associated mucin Episialin, Epithelial Membrane Antigen, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1-alpha, MUC1-beta, MUC1-CT, MUC1-NT, MUC1/ZD, Mucin 1 cell surface Asso
MBS6124379-02 5x 0.1 mL

MUC1 (EMA, CD227, Breast carcinoma-Associated antigen DF3, CA15-3, Carcinoma-Associated mucin Episialin, Epithelial Membrane Antigen, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1-alpha, MUC1-beta, MUC1-CT, MUC1-NT, MUC1/ZD, Mucin 1 cell surface Asso

Ask
View Details
TOE1, NT (TOE1, Target of EGR1 protein 1) (MaxLight 550) discontinued
043115-ML550 100 µL

TOE1, NT (TOE1, Target of EGR1 protein 1) (MaxLight 550) discontinued

Ask
View Details
cis-(-)-1,3-Dibenzylhexahydro-2-oxo-1H-thieno[3,4-d]imidazole-4-valeric Acid
TRC-D417445-100MG 100 mg

cis-(-)-1,3-Dibenzylhexahydro-2-oxo-1H-thieno[3,4-d]imidazole-4-valeric Acid

Ask
View Details