Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK11, Human (His-SUMO)

The STK11 protein is a tumor suppressor kinase that complexly regulates members of the AMP-activated protein kinase (AMPK) family, affecting cellular processes such as metabolism, apoptosis, and DNA damage responses. It phosphorylates the T-loop of AMPK family proteins and activates PRKAA1, PRKAA2 and other proteins (except MELK) . STK11 Protein, Human (His-SUMO) is the recombinant human-derived STK11 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

STK11 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stk11-protein-human-his-sumo.html

Purity

92.00

Smiles

MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSAC

Molecular Formula

6794 (Gene_ID) Q15831 (M1-C430) (Accession)

Molecular Weight

Approximately 60-72 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) (MaxLight 490)
MBS6390478-01 0.1 mL

PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) (MaxLight 490)

Sign In for Pricing
View Details
PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) (MaxLight 490)
MBS6390478-02 5x 0.1 mL

PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) (MaxLight 490)

Sign In for Pricing
View Details
Hsa-miR-4534 miRNA Antagomir
CIJ1363-01 10 nmol

Hsa-miR-4534 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4534 miRNA Antagomir
CIJ1363-02 20 nmol

Hsa-miR-4534 miRNA Antagomir

Sign In for Pricing
View Details
4933402N03Rik Mouse siRNA Oligo Duplex (Locus ID 233918)
SR410983 1 Kit

4933402N03Rik Mouse siRNA Oligo Duplex (Locus ID 233918)

Sign In for Pricing
View Details
PLIN3 Antibody
orb1925328-01 50 µL

PLIN3 Antibody

Sign In for Pricing
View Details