Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bone morphogenetic protein 4 (BMP4)

Product Specifications

Product Name Alternative

Bone morphogenetic protein 2B ; BMP-2B

Abbreviation

Recombinant Human BMP4 protein

Gene Name

BMP4

UniProt

P12644

Expression Region

293-408aa

Organism

Homo sapiens (Human)

Target Sequence

SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during bryonic mammary development and to inhibit hair follicle induction .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.4 kDa

References & Citations

Mutations in BMP4 are associated with subepithelial, microform, and overt cleft lip.Suzuki S., Marazita M.L., Cooper M.E., Miwa N., Hing A., Jugessur A., Natsume N., Shimozato K., Ohbayashi N., Suzuki Y., Niimi T., Minami K., Yamamoto M., Altannamar T.J., Erkhembaatar T., Furukawa H., Daack-Hirsch S., L'heureux J. , Brandon C.A., Weinberg S.M., Neiswanger K., Deleyiannis F.W., de Salamanca J.E., Vieira A.R., Lidral A.C., Martin J.F., Murray J.C.Am. J. Hum. Genet. 84:406-411 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal RANK/TNFRSF11A Antibody (107) [mFluor Violet 610 SE]
NBP2-90324MFV610 0.1 mL

Rabbit Monoclonal RANK/TNFRSF11A Antibody (107) [mFluor Violet 610 SE]

Ask
View Details
Recombinant Human G-CSF/ CSF3 Protein, His, E.coli-50ug
QP8545-ec-50ug 50ug

Recombinant Human G-CSF/ CSF3 Protein, His, E.coli-50ug

Ask
View Details
Immunoglobulin-Like and Fibronectin Type III domain-containing protein 1 (IGFN1) Mouse ELISA Kit
E2428 96 Tests

Immunoglobulin-Like and Fibronectin Type III domain-containing protein 1 (IGFN1) Mouse ELISA Kit

Ask
View Details
Fibroblast Activation Protein alpha (FAPa, FAP, 170kD Melanoma Membrane-bound Gelatinase, DPPIV, EC 3.4.21.-, Integral Membrane Serine Protease, Seprase)
F4208-57G 50 µg

Fibroblast Activation Protein alpha (FAPa, FAP, 170kD Melanoma Membrane-bound Gelatinase, DPPIV, EC 3.4.21.-, Integral Membrane Serine Protease, Seprase)

Ask
View Details
Fyn (NM_001122893) Mouse Tagged Lenti ORF Clone
MR227453L3 10 µg

Fyn (NM_001122893) Mouse Tagged Lenti ORF Clone

Ask
View Details