Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Necator americanus Ancylostoma secreted protein 2 (ASP2)

Product Specifications

Product Name Alternative

Secreted protein ASP-2

Abbreviation

Recombinant Necator americanus ASP2 protein

Gene Name

ASP2

UniProt

Q7Z1H1

Expression Region

20-210aa

Organism

Necator americanus (Human hookworm)

Target Sequence

GCPDNGMSEEARQKFLELHNSLRSSVALGQAKDGAGGNAPKAAKMKTMAYDCEVEKTAMNNAKQCVFKHSQPNQRKGLGENIFMSSDSGMDKAKAAEQASKAWFGELAEKGVGQNLKLTGGLFSRGVGHYTQMVWQETVKLGCYVEACSNMCYVVCQYGPAGNMMGKDIYEKGEPCSKCENCDKEKGLCSA

Tag

C-terminal 6xHis-Myc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIC1/2/3/4/5 polyclonal antibody
BS65115-01 50 µL

ZIC1/2/3/4/5 polyclonal antibody

Sign In for Pricing
View Details
ZIC1/2/3/4/5 polyclonal antibody
BS65115-02 100 µL

ZIC1/2/3/4/5 polyclonal antibody

Sign In for Pricing
View Details
Lentiviral human RPGRIP1 shRNA (UAS) - Lentiviral human RPGRIP1 shRNA (UAS, iRFP) plasmid
GTR15102748 1 Vial

Lentiviral human RPGRIP1 shRNA (UAS) - Lentiviral human RPGRIP1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
QuicKey Human ALB-Albumin- ELISA Kit
E-TSEL-H0029-01 24 Tests

QuicKey Human ALB-Albumin- ELISA Kit

Sign In for Pricing
View Details
QuicKey Human ALB-Albumin- ELISA Kit
E-TSEL-H0029-02 48 Tests

QuicKey Human ALB-Albumin- ELISA Kit

Sign In for Pricing
View Details
QuicKey Human ALB-Albumin- ELISA Kit
E-TSEL-H0029-03 96 Tests

QuicKey Human ALB-Albumin- ELISA Kit

Sign In for Pricing
View Details