Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I, Salmon

IGF-I protein is similar to insulin and exerts effective growth-promoting activity as a ligand of IGF1R. Binding to the α subunit of IGF1R activates intrinsic tyrosine kinase, triggering autophosphorylation of the β subunit. IGF-I Protein, Salmon is the recombinant IGF-I protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IGF-I Protein, Salmon, Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-protein-salmon.html

Purity

95.0

Smiles

GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA

Molecular Formula

100136741 (Gene_ID) Q02815 (G45-A114) (Accession)

Molecular Weight

Approximately 8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human COLGALT2 sgRNA gene knockout kit - Lentiviral human COLGALT2 sgRNA gene knockout kit (25)
GTR15354803 1 Vial

Lentiviral human COLGALT2 sgRNA gene knockout kit - Lentiviral human COLGALT2 sgRNA gene knockout kit (25)

Ask
View Details
Mouse Monoclonal CD133 Antibody (170411) [Alexa Fluor 532]
FAB11331X 0.1 mL

Mouse Monoclonal CD133 Antibody (170411) [Alexa Fluor 532]

Ask
View Details
Lentiviral human SHANK1 sgRNA gene knockout kit - Lentiviral human SHANK1 sgRNA gene knockout kit (plasmid)
GTR15362531 1 Vial

Lentiviral human SHANK1 sgRNA gene knockout kit - Lentiviral human SHANK1 sgRNA gene knockout kit (plasmid)

Ask
View Details
TSPYL5 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-7703R-BF405 100 µL

TSPYL5 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details
Mouse Ccl8 qPCR Primer Pair
QM05054S 200 Tests

Mouse Ccl8 qPCR Primer Pair

Ask
View Details