Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I, Salmon

IGF-I protein is similar to insulin and exerts effective growth-promoting activity as a ligand of IGF1R. Binding to the α subunit of IGF1R activates intrinsic tyrosine kinase, triggering autophosphorylation of the β subunit. IGF-I Protein, Salmon is the recombinant IGF-I protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IGF-I Protein, Salmon, Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-protein-salmon.html

Purity

95.0

Smiles

GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA

Molecular Formula

100136741 (Gene_ID) Q02815 (G45-A114) (Accession)

Molecular Weight

Approximately 8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GNE-317 50mg
A13992-50 50 mg

GNE-317 50mg

Ask
View Details
Rat ENO3 siRNA
abx915415-01 15 nmol

Rat ENO3 siRNA

Ask
View Details
Rat ENO3 siRNA
abx915415-02 30 nmol

Rat ENO3 siRNA

Ask
View Details
NSD1 (NSD-1, Nuclear Receptor Binding SET Domain Protein 1, ARA267, ARA-267, Androgen Receptor-associated Coregulator 267kD, Histone-lysine N-methyltransferase, H3 Lysine-36 and H4 Lysine-20 Specific, H3-K36-HMTase, H4-K20-HMTase, Androgen Receptor-Associated Protein of 267kD, Lysine N-methyltransferase 3B, KMT3B, DKFZp666C163, FLJ10684, FLJ22263, FLJ44628) (Biotin)
130578-Biotin 100 µL

NSD1 (NSD-1, Nuclear Receptor Binding SET Domain Protein 1, ARA267, ARA-267, Androgen Receptor-associated Coregulator 267kD, Histone-lysine N-methyltransferase, H3 Lysine-36 and H4 Lysine-20 Specific, H3-K36-HMTase, H4-K20-HMTase, Androgen Receptor-Associated Protein of 267kD, Lysine N-methyltransferase 3B, KMT3B, DKFZp666C163, FLJ10684, FLJ22263, FLJ44628) (Biotin)

Ask
View Details
Human SMAD2 knockout cell line
ABC-KH14256 1 Vial

Human SMAD2 knockout cell line

Ask
View Details
IFRD1 Polyclonal Antibody
MBS2554927-01 0.06 mL

IFRD1 Polyclonal Antibody

Ask
View Details