IGF-I, Salmon
IGF-I protein is similar to insulin and exerts effective growth-promoting activity as a ligand of IGF1R. Binding to the α subunit of IGF1R activates intrinsic tyrosine kinase, triggering autophosphorylation of the β subunit. IGF-I Protein, Salmon is the recombinant IGF-I protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IGF-I Protein, Salmon, Others, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igf-i-protein-salmon.html
Purity
95.0
Smiles
GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA
Molecular Formula
100136741 (Gene_ID) Q02815 (G45-A114) (Accession)
Molecular Weight
Approximately 8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
SH3D20, ID (ARHGAP27, CAMGAP1, SH3D20, Rho GTPase-activating protein 27, CIN85-associated multi-domain-containing Rho GTPase-activating protein 1, Rho-type GTPase-activating protein 27, SH3 domain-containing protein 20) (MaxLight 550)
SH3D20, ID (ARHGAP27, CAMGAP1, SH3D20, Rho GTPase-activating protein 27, CIN85-associated multi-domain-containing Rho GTPase-activating protein 1, Rho-type GTPase-activating protein 27, SH3 domain-containing protein 20) (MaxLight 550)
Human Tumor Necrosis Factor Alpha Induced Protein 2 (TNFaIP2) ELISA Kit