IGF-I, Salmon
IGF-I protein is similar to insulin and exerts effective growth-promoting activity as a ligand of IGF1R. Binding to the α subunit of IGF1R activates intrinsic tyrosine kinase, triggering autophosphorylation of the β subunit. IGF-I Protein, Salmon is the recombinant IGF-I protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IGF-I Protein, Salmon, Others, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igf-i-protein-salmon.html
Purity
95.0
Smiles
GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA
Molecular Formula
100136741 (Gene_ID) Q02815 (G45-A114) (Accession)
Molecular Weight
Approximately 8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881120-100 1x 100 µL
Ep-CAM / CD326 (EGP40/1120), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042013-100 1x 100 µL
CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400723-500 1x 500 µL
P53 (BP53-12 + DO-7), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details