Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-1, Mouse (HEK293, His)

Kallikrein-1 protein is a member of the glandular kallikrein family and plays a vital role in enzyme activity by cleaving the Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin..This proteolysis is critical for the production of bradykinin, a bioactive peptide involved in multiple physiological processes, including blood pressure regulation, inflammation, and vascular permeability.Kallikrein-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-1-protein-mouse-hek-293-his.html

Smiles

PPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND

Molecular Formula

16612 (Gene_ID) P15947 (P19-D261) (Accession)

Molecular Weight

Approximately 34-38 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-100 1x 100 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-100 1x 100 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-500 1x 500 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details