Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGIT, Cynomolgus (HEK293, His)

Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions, therefore being involved in biological processes such as down-regulation of T cell activation or cardiac and neuronal development. TIGIT Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIGIT Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tigit-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

Molecular Formula

102121588 (Gene_ID) G7NXM4/XP_015300911.1 (M89-P209) (Accession)

Molecular Weight

16-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV-Tet-miniCMV-TRIM71-GFP-nanobody-mCherry-Puro Plasmid
PVT78416 2 µg

PLV-Tet-miniCMV-TRIM71-GFP-nanobody-mCherry-Puro Plasmid

Sign In for Pricing
View Details
ACSF2 siRNA (Rat)
CRR6713-01 15 nmol

ACSF2 siRNA (Rat)

Sign In for Pricing
View Details
ACSF2 siRNA (Rat)
CRR6713-02 30 nmol

ACSF2 siRNA (Rat)

Sign In for Pricing
View Details
Tmem106c (NM_201359) Mouse Tagged Lenti ORF Clone
MR203384L4 10 µg

Tmem106c (NM_201359) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olr1092 AAV siRNA Pooled Vector
33668166 1.0 µg

Olr1092 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SYS1 Human Over-expression Lysate
orb1372392 20 µg

SYS1 Human Over-expression Lysate

Sign In for Pricing
View Details