ENA-78/CXCL5, Human

CXCL5, also known as neutrophil activating peptide 78 (ENA‐78), is a CXC chemokine containing ELR motif. CXCL5 promotes angiogenesis through interaction with its specific receptor CXCR2. CXCL5 is expressed by many immune cells, such as macrophages, eosinophils, and non-immune cells including mesothelial cells, and fibroblasts.CXCL5/CXCR2 axis not only contributes to the recruitment of neutrophils but also regulates the function of neutrophils in melanoma[1][2]. ENA-78/CXCL5 Protein, Human is produced in E.coil, and consists of 70 amino acids (R45-N114) .

Product Specifications

Product Name Alternative

ENA-78/CXCL5 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ena-78-cxcl5-protein-human.html

Purity

95.00

Smiles

RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Molecular Formula

6374 (Gene_ID) P42830 (R45-N114) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kawamura M, et al. CXCL5, a promoter of cell proliferation, migration and invasion, is a novel serum prognostic marker in patients with colorectal cancer. Eur J Cancer. 2012 Sep;48 (14) :2244-51.|[2]Kawamura M, et al. CXCL5, a promoter of cell proliferation, migration and invasion, is a novel serum prognostic marker in patients with colorectal cancer. Eur J Cancer. 2012 Sep;48 (14) :2244-51.|[3]Wen Zhang, et al. CXCL5/CXCR2 axis in tumor microenvironment as potential diagnostic biomarker and therapeutic target. Cancer Commun (Lond) . 2020 Mar;40 (2-3) :69-80.