LIGHT/TNFSF14, Human (HEK293, Fc)

DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

[1]Mauri DN, et al. LIGHT, a new member of the TNF superfamily, and lymphotoxin alpha are ligands for herpesvirus entry mediator. Immunity. 1998 Jan;8 (1) :21-30.|[2]Han M, et al. Comprehensive characterization of TNFSF14/LIGHT with implications in prognosis and immunotherapy of human gliomas. Front Immunol. 2022 Oct 20;13:1025286.|[3]Manresa MC, et al. LIGHT controls distinct homeostatic and inflammatory gene expression profiles in esophageal fibroblasts via differential HVEM and LTβR-mediated mechanisms. Mucosal Immunol. 2022 Feb;15 (2) :327-337.|[4]Hou Y, et al. Dual Roles of Tumor Necrosis Factor Superfamily 14 in Antiviral Immunity. Viral Immunol. 2022 Nov;35 (9) :579-585.|[5]Miao X, et al. HES5-mediated repression of LIGHT transcription may contribute to apoptosis in hepatocytes. Cell Death Discov. 2021 Oct 23;7 (1) :308.|[6]Zhang H, et al. TNFSF14, a novel target of miR-326, facilitates airway remodeling in airway smooth muscle cells via inducing extracellular matrix protein deposition and proliferation. Kaohsiung J Med Sci. 2020 Jul;36 (7) :508-514.|[7]Holmes TD, et al. Licensed human natural killer cells aid dendritic cell maturation via TNFSF14/LIGHT. Proc Natl Acad Sci U S A. 2014 Dec 30;111 (52) :E5688-96.