Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Growth/differentiation factor 8 (MSTN)

Product Specifications

Product Name Alternative

(Myostatin)

Abbreviation

Recombinant Cat MSTN protein

Gene Name

MSTN

UniProt

M3WPT7

Expression Region

19-375aa

Organism

Felis catus (Cat) (Felis silvestris catus)

Target Sequence

GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acts specifically as a negative regulator of skeletal muscle growth.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.7 kDa

References & Citations

"Initial sequence and comparative analysis of the cat genome." Pontius J.U., Mullikin J.C., Smith D.R., Lindblad-Toh K., Gnerre S., Clamp M., Chang J., Stephens R., Neelam B., Volfovsky N., Schaffer A.A., Agarwala R., Narfstrom K., Murphy W.J., Giger U., Roca A.L., Antunes A., Menotti-Raymond M. O'Brien S.J. Genome Res. 17:1675-1689 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), CF568 conjugate, 0.1mg/mL
BNC683063-100 1x 100 µL

CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
c-Myb (MYB) (NM_001161657) Human Over-expression Lysate
LY431477 100 µg

c-Myb (MYB) (NM_001161657) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Secretagogin (SCGN) ELISA Kit
RD-SCGN-Ra-01 96 Tests

Rat Secretagogin (SCGN) ELISA Kit

Sign In for Pricing
View Details
Rat Secretagogin (SCGN) ELISA Kit
RD-SCGN-Ra-02 48 Tests

Rat Secretagogin (SCGN) ELISA Kit

Sign In for Pricing
View Details
FANCF Rabbit Polyclonal Antibody
TA364788 100 µL

FANCF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5’-Tosyl Adenosine
TRC-T550100-5G 5 g

5’-Tosyl Adenosine

Sign In for Pricing
View Details